DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr14 and KIRREL2

DIOPT Version :9

Sequence 1:NP_001245573.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_954649.3 Gene:KIRREL2 / 84063 HGNCID:18816 Length:708 Species:Homo sapiens


Alignment Length:216 Identity:50/216 - (23%)
Similarity:70/216 - (32%) Gaps:36/216 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 PFPFFADPYTTLNISTQLSSSVYLHCRVNDLQGKTVSWMRRRGDDLTLITFGQHTYSGDSRYSLE 135
            |.|.|......|.:  .|.....|.|.:....| .|.|.:.     .|...||....|.|||.:.
Human    22 PSPHFLQQPEDLVV--LLGEEARLPCALGAYWG-LVQWTKS-----GLALGGQRDLPGWSRYWIS 78

  Fly   136 FEEPN-DWKLLIQFANERDEGPYECQVS-----SHPPLVLLVYLTIIVP--HVEILDERGSATPE 192
            ....| ...|.|:.....||..||||.:     |.|     ..|.::||  ..::|     ..|.
Human    79 GNAANGQHDLHIRPVELEDEASYECQATQAGLRSRP-----AQLHVLVPPEAPQVL-----GGPS 133

  Fly   193 KYYKAGSTIELQCVISKIPHPSSYITWRHGPRLLNYDTSRGGISVKTDML----PGRALSRLYIA 253
            ....||....|.|.......|:..:.|.....||:      |.:....:|    ||...|.|.:.
Human   134 VSLVAGVPANLTCRSRGDARPTPELLWFRDGVLLD------GATFHQTLLKEGTPGSVESTLTLT 192

  Fly   254 NANRQDTGNYTCMLGNEITET 274
            ..:..|...:.|...::...|
Human   193 PFSHDDGATFVCRARSQALPT 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr14NP_001245573.1 IG_like 83..163 CDD:214653 22/85 (26%)
Ig 84..169 CDD:299845 24/90 (27%)
IG_like 191..279 CDD:214653 18/88 (20%)
Ig 201..274 CDD:143165 14/76 (18%)
KIRREL2NP_954649.3 IG_like 30..119 CDD:214653 26/101 (26%)
IGc2 38..106 CDD:197706 21/73 (29%)
I-set 126..224 CDD:254352 19/99 (19%)
Ig2_KIRREL3-like 141..223 CDD:143236 15/79 (19%)
Cell attachment site. /evidence=ECO:0000255 149..151 0/1 (0%)
Ig 231..306 CDD:299845
IG_like 234..308 CDD:214653
Ig 312..395 CDD:299845
I-set 317..395 CDD:254352
Ig 397..501 CDD:299845
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 545..601
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.