DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr14 and nectin3a

DIOPT Version :10

Sequence 1:NP_572419.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster
Sequence 2:XP_073779583.1 Gene:nectin3a / 793240 ZFINID:ZDB-GENE-130530-670 Length:644 Species:Danio rerio


Alignment Length:282 Identity:53/282 - (18%)
Similarity:95/282 - (33%) Gaps:94/282 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 ISTQLSSSVYLHCRV---NDLQGKTVSWMRRRGDD-LTLITFGQ-HTYSGDSRYS--LEFEEP-- 139
            :::.|..:|.|.||:   ::|.....||.|..... :||..|.. :..|....||  :.|.:|  
Zfish    43 VTSVLGKNVTLSCRMEMSSNLSLTQSSWERHLPSGIITLAVFNPVYGTSVADEYSRRVHFLKPSV 107

  Fly   140 NDWKLLIQFANERDEGPYEC----------QVSSHPPLVL--LVY-----LTIIVPHVEIL---- 183
            :|..:::|.....|.|.|.|          |.|::..:::  .||     |::.....|.|    
Zfish   108 HDVSIVLQGVGFADIGMYTCKMVTFELGNMQASTNVDVMVEPKVYVSPGSLSLTADDGETLVATC 172

  Fly   184 -DERGSATPEKYYKA---------------GSTI----------------ELQCVIS-------- 208
             .|||....|.::::               |:|.                .|.||:.        
Zfish   173 TAERGRPAAEVFWESDLPGQTAVVTQSEPEGTTTTLVHYVLAPTRASHGRSLSCVVRHPALSRDF 237

  Fly   209 KIPH-------PSSYI-----TWRHGPRLLNYDTSRGG-------ISVKTDMLPGRAL-----SR 249
            :||:       |...:     .|..|.:.:..|.....       :..:.|.|....:     |.
Zfish   238 RIPYRLNVFFVPDVMVIGGKNVWYVGQKDVQLDCKANANPPALFYLWTRLDALMPAGVNMHNGSL 302

  Fly   250 LYIANANRQDTGNYTCMLGNEI 271
            ::.......|:|.|.|.:.|::
Zfish   303 VFTRPLEATDSGQYRCEVQNDV 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr14NP_572419.1 Ig 81..175 CDD:472250 28/116 (24%)
Ig strand B 92..96 CDD:409353 2/3 (67%)
Ig strand C 105..109 CDD:409353 1/3 (33%)
Ig strand E 142..146 CDD:409353 0/3 (0%)
Ig strand F 156..161 CDD:409353 2/14 (14%)
Ig strand G 168..171 CDD:409353 0/4 (0%)
IG_like 191..279 CDD:214653 20/144 (14%)
Ig strand B 201..205 CDD:409473 1/19 (5%)
Ig strand C 214..220 CDD:409473 0/10 (0%)
Ig strand E 248..252 CDD:409473 1/3 (33%)
Ig strand F 262..267 CDD:409473 2/4 (50%)
nectin3aXP_073779583.1 None

Return to query results.
Submit another query.