Sequence 1: | NP_001245573.1 | Gene: | dpr14 / 31702 | FlyBaseID: | FBgn0029974 | Length: | 340 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001137799.1 | Gene: | DIP-epsilon / 7354433 | FlyBaseID: | FBgn0259714 | Length: | 467 | Species: | Drosophila melanogaster |
Alignment Length: | 289 | Identity: | 62/289 - (21%) |
---|---|---|---|
Similarity: | 98/289 - (33%) | Gaps: | 96/289 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 73 PFFADPYTTLNISTQLSSSVYLHCRVNDLQGKTVSWMRRRGDDLTLITFGQHTYSGDSRYSL--- 134
Fly 135 EFEEPNDWKLLIQFANERDEGPYECQVSSHPPLVLLVYLTIIV-PHVE--------ILDE----- 185
Fly 186 -----RGSATPEKYYKAG------------------STIELQ-----------CVISKIPHPS-- 214
Fly 215 ---------SYITW--------------------RHGPRLLNYDTSRGGISV------KTDMLPG 244
Fly 245 ----RALSRLYIANANRQDTGNYTCMLGN 269 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr14 | NP_001245573.1 | IG_like | 83..163 | CDD:214653 | 23/82 (28%) |
Ig | 84..169 | CDD:299845 | 22/87 (25%) | ||
IG_like | 191..279 | CDD:214653 | 30/149 (20%) | ||
Ig | 201..274 | CDD:143165 | 28/121 (23%) | ||
DIP-epsilon | NP_001137799.1 | IG_like | 59..155 | CDD:214653 | 23/97 (24%) |
Ig | 69..139 | CDD:143165 | 20/71 (28%) | ||
IG_like | 165..249 | CDD:214653 | 12/83 (14%) | ||
IGc2 | 172..237 | CDD:197706 | 9/64 (14%) | ||
IG_like | 267..348 | CDD:214653 | 20/70 (29%) | ||
Ig | 270..339 | CDD:299845 | 20/67 (30%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 46 | 1.000 | Domainoid score | I11916 |
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |