DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr14 and DIP-epsilon

DIOPT Version :9

Sequence 1:NP_001245573.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster


Alignment Length:289 Identity:62/289 - (21%)
Similarity:98/289 - (33%) Gaps:96/289 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 PFFADPYTTLNISTQLSSSVYLHCRVNDLQGKTVSWMRRRGDDLTLITFGQHTYSGDSRYSL--- 134
            |.|.|  ...||:.....:|.|.|.|.:|....|:||  ..:...::|...|..:.:.|.|:   
  Fly    52 PEFTD--VIENITVPAGRNVKLACSVKNLGSYKVAWM--HFEQSAILTVHNHVITRNPRISVTHD 112

  Fly   135 EFEEPNDWKLLIQFANERDEGPYECQVSSHPPLVLLVYLTIIV-PHVE--------ILDE----- 185
            :.::...|.|.|....|.|.|.|.||:::........::.::| |:::        |:.|     
  Fly   113 KHDKHRTWFLHINNVQEEDRGRYMCQINTVTAKTQYGFVKVVVPPNIDDALTSSDIIVREGDNVT 177

  Fly   186 -----RGSATPEKYYKAG------------------STIELQ-----------CVISKIPHPS-- 214
                 :||..|...:|..                  .::||:           |:.|....||  
  Fly   178 LRCKAKGSPEPTIKWKRDDGNKIVINKTLEVHDLETDSLELERISRLHMGAYLCIASNGVPPSVS 242

  Fly   215 ---------SYITW--------------------RHGPRLLNYDTSRGGISV------KTDMLPG 244
                     |.:.|                    ...|..|||.|......:      ||:.:||
  Fly   243 KRIKVSVDFSPMVWIPHQLVGIPIGFNITLECFIEANPTSLNYWTRENDQMITESSKYKTETIPG 307

  Fly   245 ----RALSRLYIANANRQDTGNYTCMLGN 269
                :|..||.|.|....|.|||.|:..|
  Fly   308 HPSYKATMRLTITNVQSSDYGNYKCVAKN 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr14NP_001245573.1 IG_like 83..163 CDD:214653 23/82 (28%)
Ig 84..169 CDD:299845 22/87 (25%)
IG_like 191..279 CDD:214653 30/149 (20%)
Ig 201..274 CDD:143165 28/121 (23%)
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 23/97 (24%)
Ig 69..139 CDD:143165 20/71 (28%)
IG_like 165..249 CDD:214653 12/83 (14%)
IGc2 172..237 CDD:197706 9/64 (14%)
IG_like 267..348 CDD:214653 20/70 (29%)
Ig 270..339 CDD:299845 20/67 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.