DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr14 and CADM3

DIOPT Version :9

Sequence 1:NP_001245573.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster
Sequence 2:XP_024304528.1 Gene:CADM3 / 57863 HGNCID:17601 Length:481 Species:Homo sapiens


Alignment Length:333 Identity:62/333 - (18%)
Similarity:111/333 - (33%) Gaps:113/333 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 ADPYTTLNISTQLSSSVYLHCRVNDLQGKTVSWMRRRGDDLTLITFGQHTYSGDSRYSLEFEEPN 140
            :.|:|: :.:.....:|.|.|:|.|.:..::.|.......|   .||:.....|:|..|....|:
Human   114 SQPWTS-DETVVAGGTVVLKCQVKDHEDSSLQWSNPAQQTL---YFGEKRALRDNRIQLVTSTPH 174

  Fly   141 DWKLLIQFANERDEGPYECQVSSHPPLVLLVYLTII-VPHVEILDERGSATPEKYYKAGSTIELQ 204
            :..:.|......|||.|.|.:.:.|.......:|:: :|...|:....|:..||     .|..|.
Human   175 ELSISISNVALADEGEYTCSIFTMPVRTAKSLVTVLGIPQKPIITGYKSSLREK-----DTATLN 234

  Fly   205 CVISKIPHPSSYITWRHGPRLLNYDTSR-------------------------GG---ISVKTDM 241
            |. |....|::.:|||.|.:.|:.:.:|                         |.   .||..:.
Human   235 CQ-SSGSKPAARLTWRKGDQELHGEPTRIQEDPNGKTFTVSSSVTFQVTREDDGASIVCSVNHES 298

  Fly   242 LPG--RALSR----LYIANA--------------------------------------------- 255
            |.|  |:.|:    ||...|                                             
Human   299 LKGADRSTSQRIEVLYTPTAMIRPDPPHPREGQKLLLHCEGRGNPVPQQYLWEKEGSVPPLKMTQ 363

  Fly   256 ---------NRQDTGNYTCMLGNEITETVVVHVLNGEEPAAMQHANGSRQKANASTM------VV 305
                     |:.|:|.|.|...:.:......:.||..:|:.:        .:::||.      :|
Human   364 ESALIFPFLNKSDSGTYGCTATSNMGSYKAYYTLNVNDPSPV--------PSSSSTYHAIIGGIV 420

  Fly   306 LFLVYVCI 313
            .|:|::.:
Human   421 AFIVFLLL 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr14NP_001245573.1 IG_like 83..163 CDD:214653 19/79 (24%)
Ig 84..169 CDD:299845 20/84 (24%)
IG_like 191..279 CDD:214653 28/175 (16%)
Ig 201..274 CDD:143165 25/160 (16%)
CADM3XP_024304528.1 Ig1_Necl-1 115..209 CDD:143290 22/97 (23%)
Ig2_Necl-1 230..312 CDD:143329 18/82 (22%)
IG_like 328..399 CDD:214653 6/70 (9%)
4.1m 437..452 CDD:128590
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I5236
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.