Sequence 1: | NP_001245573.1 | Gene: | dpr14 / 31702 | FlyBaseID: | FBgn0029974 | Length: | 340 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_024304528.1 | Gene: | CADM3 / 57863 | HGNCID: | 17601 | Length: | 481 | Species: | Homo sapiens |
Alignment Length: | 333 | Identity: | 62/333 - (18%) |
---|---|---|---|
Similarity: | 111/333 - (33%) | Gaps: | 113/333 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 76 ADPYTTLNISTQLSSSVYLHCRVNDLQGKTVSWMRRRGDDLTLITFGQHTYSGDSRYSLEFEEPN 140
Fly 141 DWKLLIQFANERDEGPYECQVSSHPPLVLLVYLTII-VPHVEILDERGSATPEKYYKAGSTIELQ 204
Fly 205 CVISKIPHPSSYITWRHGPRLLNYDTSR-------------------------GG---ISVKTDM 241
Fly 242 LPG--RALSR----LYIANA--------------------------------------------- 255
Fly 256 ---------NRQDTGNYTCMLGNEITETVVVHVLNGEEPAAMQHANGSRQKANASTM------VV 305
Fly 306 LFLVYVCI 313 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr14 | NP_001245573.1 | IG_like | 83..163 | CDD:214653 | 19/79 (24%) |
Ig | 84..169 | CDD:299845 | 20/84 (24%) | ||
IG_like | 191..279 | CDD:214653 | 28/175 (16%) | ||
Ig | 201..274 | CDD:143165 | 25/160 (16%) | ||
CADM3 | XP_024304528.1 | Ig1_Necl-1 | 115..209 | CDD:143290 | 22/97 (23%) |
Ig2_Necl-1 | 230..312 | CDD:143329 | 18/82 (22%) | ||
IG_like | 328..399 | CDD:214653 | 6/70 (9%) | ||
4.1m | 437..452 | CDD:128590 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 79 | 1.000 | Inparanoid score | I5236 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.960 |