DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr14 and aebp1b

DIOPT Version :9

Sequence 1:NP_001245573.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster
Sequence 2:XP_696022.6 Gene:aebp1b / 567630 ZFINID:ZDB-GENE-030131-8546 Length:1247 Species:Danio rerio


Alignment Length:177 Identity:38/177 - (21%)
Similarity:70/177 - (39%) Gaps:48/177 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 VLLVYLTIIVPHVEI-------------------LDERGSATPE-----KYYKAGSTIEL---QC 205
            ::::.|:::||..|:                   :::|...:.|     |.....:|||:   :.
Zfish    10 LVVLCLSLLVPSWEVNGLTEHSKSEISHTDREQHVEDRNVTSVEDLLQVKIIPPYATIEVGQHKQ 74

  Fly   206 VISKIPHPSSYITW--RHGPRLLNYDTSRGGISVKTDMLPGRALSRLYIANANRQDTGNYTCMLG 268
            ::.|:...:..|.|  .:|.::|   |..|.:.|...   |..||.|.:.|||..:.|.|.|:..
Zfish    75 LLCKVSSDAKNINWVSPNGEKVL---TKHGNLKVHNH---GSVLSSLTVLNANLNNAGIYKCVAT 133

  Fly   269 NEITE---TVVVHVL----------NGEEPAAMQHANGSRQKANAST 302
            |..||   ||.:.::          .|.|....:.....:.||:..|
Zfish   134 NGDTESQATVKLDIILKRMRRDTDRKGREKRLKEPKPSKKPKASKPT 180

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
dpr14NP_001245573.1 IG_like 83..163 CDD:214653