DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr14 and pvrl2l

DIOPT Version :10

Sequence 1:NP_572419.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001417821.1 Gene:pvrl2l / 560933 ZFINID:ZDB-GENE-060503-249 Length:508 Species:Danio rerio


Alignment Length:337 Identity:58/337 - (17%)
Similarity:103/337 - (30%) Gaps:123/337 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 SSSVYLHCRVNDLQGKT----VSWM--RRRGDDLTLITFGQHTYSGDSRYSLEF----------- 136
            :.||.|.|...: .|.|    ||||  |...|...:..|  |...|.|..:.:|           
Zfish    39 NGSVNLRCEFTN-SGTTKLTQVSWMFERAENDRQNIAVF--HPQYGASFPNKDFEGRVKFTQGSL 100

  Fly   137 EEPNDWKLLIQFANERDEGPYECQVSSHP------------------------------------ 165
            |.|:   :.|......|.|.|.|:.:::|                                    
Zfish   101 ENPS---IRIDKLRMADAGRYICEYATYPSGNEQGTTTLIMLAKPKNSATAIPVRAGTSEVVVAT 162

  Fly   166 -------PLVLLVYLTIIV---PHVEILDERGSATPEKYYKAGST-----IELQCVISK------ 209
                   |...:.::|.|.   .|..:.:..|:.|.:..|:...|     .|:.||:::      
Zfish   163 CAAAQGKPEATISWITTITGRYNHTSVPESDGTVTVKSEYRMIPTPVENGKEITCVVNQRTQMED 227

  Fly   210 --------IPHPSS-----------------YITWRHGPRLLNYDTSRGGISVKTDMLPGRAL-- 247
                    :.:|.:                 |:|....   .|.:.|....:|.|..:|....  
Zfish   228 KVFNLKLVVEYPPTVTIDGYDNNWYMGRTDVYLTCEAD---ANPEPSEISWTVATGQMPSSVRVE 289

  Fly   248 -SRLYIANANRQDTGNYTCMLGNEI----TETVVVHVLNGEEPAAMQHANGSRQKANASTMVVLF 307
             :||.:...:......:.|.:.|.:    .|.|.:.:.:.|:|        |.....|..::..|
Zfish   290 ENRLLVRKVDETVNTTFVCEVKNRLGTGKKELVALVIESTEDP--------SSAGVVAGAILGSF 346

  Fly   308 LVYVCISGSISV 319
            |..|.:...::|
Zfish   347 LALVLVGALVTV 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr14NP_572419.1 Ig 81..175 CDD:472250 26/145 (18%)
Ig strand B 92..96 CDD:409353 2/3 (67%)
Ig strand C 105..109 CDD:409353 3/7 (43%)
Ig strand E 142..146 CDD:409353 0/3 (0%)
Ig strand F 156..161 CDD:409353 2/4 (50%)
Ig strand G 168..171 CDD:409353 0/2 (0%)
IG_like 191..279 CDD:214653 19/130 (15%)
Ig strand B 201..205 CDD:409473 1/3 (33%)
Ig strand C 214..220 CDD:409473 2/22 (9%)
Ig strand E 248..252 CDD:409473 2/3 (67%)
Ig strand F 262..267 CDD:409473 1/4 (25%)
pvrl2lNP_001417821.1 IgV_1_PVR_like 26..138 CDD:409383 25/104 (24%)
FR1 26..49 CDD:409383 4/9 (44%)
Ig strand A 26..30 CDD:409383
Ig strand A' 32..36 CDD:409383
Ig strand B 41..49 CDD:409383 4/7 (57%)
CDR1 50..56 CDD:409383 2/6 (33%)
FR2 57..63 CDD:409383 3/5 (60%)
Ig strand C 58..63 CDD:409383 3/4 (75%)
CDR2 64..84 CDD:409383 5/21 (24%)
Ig strand C' 74..79 CDD:409383 2/6 (33%)
Ig strand C' 81..85 CDD:409383 2/3 (67%)
FR3 85..122 CDD:409383 8/39 (21%)
Ig strand D 93..96 CDD:409383 0/2 (0%)
Ig strand E 102..109 CDD:409383 2/9 (22%)
Ig strand F 116..124 CDD:409383 3/7 (43%)
CDR3 125..128 CDD:409383 1/2 (50%)
Ig strand G 128..138 CDD:409383 0/9 (0%)
FR4 129..138 CDD:409383 0/8 (0%)
IgC1_2_Nectin-2_Necl-5_like 142..237 CDD:409500 11/94 (12%)
Ig strand A 142..148 CDD:409500 0/5 (0%)
Ig strand B 159..166 CDD:409500 0/6 (0%)
Ig strand C 171..177 CDD:409500 0/5 (0%)
Ig strand C' 179..181 CDD:409500 0/1 (0%)
Ig strand D 184..192 CDD:409500 1/7 (14%)
Ig strand E 196..204 CDD:409500 2/7 (29%)
Ig strand F 214..221 CDD:409500 3/6 (50%)
Ig strand G 227..233 CDD:409500 0/5 (0%)
Ig 240..325 CDD:472250 13/87 (15%)
Ig strand B 258..262 CDD:409524 1/3 (33%)
Ig strand C 272..276 CDD:409524 0/3 (0%)
Ig strand E 291..295 CDD:409524 2/3 (67%)
Ig strand F 305..310 CDD:409524 1/4 (25%)
Ig strand G 320..323 CDD:409524 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.