DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr14 and igsf9b

DIOPT Version :9

Sequence 1:NP_001245573.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster
Sequence 2:XP_686205.6 Gene:igsf9b / 553348 ZFINID:ZDB-GENE-060810-28 Length:2021 Species:Danio rerio


Alignment Length:288 Identity:64/288 - (22%)
Similarity:95/288 - (32%) Gaps:85/288 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 STTLKRPRAGDPFDTFPKNFWQEFSSPFTDTPEDEELEVTETT---------------------- 67
            |.||.....|:|..|.   .|:::.|.   ..:.||::|...|                      
Zfish   158 SLTLHCDAHGNPKPTI---IWRKYLSA---AEKQEEIQVLNETLSLSKVTRETAGIYKCHVSNSE 216

  Fly    68 ---THE--------PFPFFADPYTTLNISTQLSSSVYLHCRVNDLQGK-TVSWMRRRGDDLTLIT 120
               ||.        |....|...||:|    :|....|.|:....... |..|.::         
Zfish   217 GNLTHSTQLQVKGPPIIIIAPEDTTMN----MSQDAVLQCQAEAYPSNLTYEWWKQ--------- 268

  Fly   121 FGQHTYSGD---SRYSLEFEEPNDWKLLIQFANERDEGPYECQVSS---HPPLVLLVYLTIIVPH 179
             ||:.|..:   ||..:..    |..|||......|.|.|.|:.::   .|| ....|||:..|.
Zfish   269 -GQNVYHIEILKSRVKILV----DGTLLISALIPDDSGNYTCRPTNGLMTPP-AASAYLTVKHPA 327

  Fly   180 VEILDERGSATPEKYYKAGSTIELQCVISKIPHPSSYITWRHGPRLLNYDTSRGGISVKTDMLPG 244
            ..:...|     |.|...|...::.|.:...| |..|:.|           ::.|.|:..:..||
Zfish   328 RVVRMPR-----ETYLPMGMGGKIPCPVQAEP-PMLYVNW-----------TKDGASLNLEQYPG 375

  Fly   245 ---RALSRLYIANANRQDTGNYTCMLGN 269
               .:...::|..||....|.|||...|
Zfish   376 WMVNSEGSVFITAANDDAVGMYTCTAYN 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr14NP_001245573.1 IG_like 83..163 CDD:214653 19/83 (23%)
Ig 84..169 CDD:299845 20/91 (22%)
IG_like 191..279 CDD:214653 20/82 (24%)
Ig 201..274 CDD:143165 17/72 (24%)
igsf9bXP_686205.6 Ig 27..132 CDD:299845
IG_like 148..227 CDD:214653 14/74 (19%)
IGc2 156..217 CDD:197706 12/64 (19%)
Ig 237..323 CDD:299845 25/104 (24%)
IG_like 237..323 CDD:214653 25/104 (24%)
Ig 345..411 CDD:143165 17/71 (24%)
IG_like 435..507 CDD:214653
IGc2 437..496 CDD:197706
FN3 512..603 CDD:238020
FN3 621..709 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.