DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr14 and KIRREL1

DIOPT Version :9

Sequence 1:NP_001245573.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster
Sequence 2:XP_005245362.1 Gene:KIRREL1 / 55243 HGNCID:15734 Length:773 Species:Homo sapiens


Alignment Length:290 Identity:54/290 - (18%)
Similarity:93/290 - (32%) Gaps:63/290 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 EELEVTETTTHEPFPFFADPY--------------TTLNI-------------STQLSSSVYLHC 96
            |:...:...|:..:.||.:|.              |.:|:             :|.:.|.|.|.|
Human   265 EDAHESRYETNVDYSFFTEPVSCEVHNKVGSTNVSTLVNVHFAPRIVVDPKPTTTDIGSDVTLTC 329

  Fly    97 RVNDLQGKTVSWMRRRGDDLTLITFGQHTYSGDSRYSLEFEE-PNDWKLLIQFANERDEGPYECQ 160
            ........|::|.::..:      .|..........:|..:. .|..:||::...:.|.|.|.|:
Human   330 VWVGNPPLTLTWTKKDSN------MGPRPPGSPPEAALSAQVLSNSNQLLLKSVTQADAGTYTCR 388

  Fly   161 VSSHPPLVLLVYLTIIVPHVEILDERG----------SATPEKYYKAGSTIELQCVISKIPHPSS 215
            .              |||.:.:.:...          |:...:|...|...:::|.|...| |..
Human   389 A--------------IVPRIGVAEREVPLYVNGPPIISSEAVQYAVRGDGGKVECFIGSTP-PPD 438

  Fly   216 YITWRHGPRLLNYDTSRGGISVKTDMLPGRALSRLYIANANRQD-TGNYTCMLGNEITETVVVHV 279
            .|.|......|...|.......:|:...| .||.|.|.|....| ..:|.|...|.......:..
Human   439 RIAWAWKENFLEVGTLERYTVERTNSGSG-VLSTLTINNVMEADFQTHYNCTAWNSFGPGTAIIQ 502

  Fly   280 LNGEEPAAMQHANGSRQKANASTMVVLFLV 309
            |...|...:....|:  ...||.:::.|.:
Human   503 LEEREVLPVGIIAGA--TIGASILLIFFFI 530

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr14NP_001245573.1 IG_like 83..163 CDD:214653 17/93 (18%)
Ig 84..169 CDD:299845 16/98 (16%)
IG_like 191..279 CDD:214653 21/88 (24%)
Ig 201..274 CDD:143165 19/73 (26%)
KIRREL1XP_005245362.1 I-set 22..116 CDD:254352
Ig 25..116 CDD:299845
Ig2_KIRREL3-like 138..219 CDD:143236
I-set 223..304 CDD:254352 6/38 (16%)
Ig_2 227..305 CDD:290606 7/39 (18%)
Ig_2 311..405 CDD:290606 19/113 (17%)
IG_like 314..405 CDD:214653 19/110 (17%)
Ig5_KIRREL3 407..504 CDD:143306 22/98 (22%)
IG_like 416..504 CDD:214653 21/89 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.