| Sequence 1: | NP_001245573.1 | Gene: | dpr14 / 31702 | FlyBaseID: | FBgn0029974 | Length: | 340 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_017451354.1 | Gene: | Ntm / 50864 | RGDID: | 620958 | Length: | 367 | Species: | Rattus norvegicus |
| Alignment Length: | 228 | Identity: | 57/228 - (25%) |
|---|---|---|---|
| Similarity: | 91/228 - (39%) | Gaps: | 39/228 - (17%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 72 FPFFADPYTTLNISTQLSSSVYLHCRVNDLQGKTVSWMRRRGDDLTLITFGQHTYSGDSRYSLEF 136
Fly 137 EEPNDWKLLIQFANERDEGPYEC--QVSSHPPLVLLVYLTIIVPH-VEILDERGSATPEKYYKAG 198
Fly 199 STIELQCVISKIPHPSSYITWRH-GPRLLNYDTSRGGISVKTDMLPGRALSRLYIANANRQDTGN 262
Fly 263 YTCMLGNEITETVVVHV-LNGEEPAAMQHANGS 294 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| dpr14 | NP_001245573.1 | IG_like | 83..163 | CDD:214653 | 22/81 (27%) |
| Ig | 84..169 | CDD:299845 | 23/86 (27%) | ||
| IG_like | 191..279 | CDD:214653 | 22/88 (25%) | ||
| Ig | 201..274 | CDD:143165 | 19/73 (26%) | ||
| Ntm | XP_017451354.1 | Ig | 44..132 | CDD:416386 | 24/92 (26%) |
| Ig strand A' | 44..49 | CDD:409353 | 1/4 (25%) | ||
| Ig strand B | 51..59 | CDD:409353 | 3/7 (43%) | ||
| CDR1 | 59..63 | CDD:409353 | 1/4 (25%) | ||
| FR2 | 64..70 | CDD:409353 | 2/5 (40%) | ||
| Ig strand C | 64..70 | CDD:409353 | 2/5 (40%) | ||
| CDR2 | 71..83 | CDD:409353 | 3/15 (20%) | ||
| Ig strand C' | 72..76 | CDD:409353 | 1/7 (14%) | ||
| Ig strand C' | 80..83 | CDD:409353 | 0/2 (0%) | ||
| FR3 | 84..118 | CDD:409353 | 11/33 (33%) | ||
| Ig strand D | 87..94 | CDD:409353 | 2/6 (33%) | ||
| Ig strand E | 97..103 | CDD:409353 | 0/5 (0%) | ||
| Ig strand F | 110..118 | CDD:409353 | 5/7 (71%) | ||
| CDR3 | 119..123 | CDD:409353 | 0/3 (0%) | ||
| Ig strand G | 123..132 | CDD:409353 | 1/8 (13%) | ||
| FR4 | 125..132 | CDD:409353 | 0/6 (0%) | ||
| Ig_3 | 136..205 | CDD:404760 | 23/92 (25%) | ||
| Ig strand A' | 144..148 | CDD:409353 | 0/3 (0%) | ||
| Ig strand B | 151..160 | CDD:409353 | 3/8 (38%) | ||
| Ig strand F | 197..205 | CDD:409353 | 3/7 (43%) | ||
| Ig | 223..307 | CDD:416386 | 2/9 (22%) | ||
| putative Ig strand A | 223..229 | CDD:409353 | 0/5 (0%) | ||
| Ig strand B | 239..243 | CDD:409353 | |||
| Ig strand C | 252..256 | CDD:409353 | |||
| Ig strand E | 278..282 | CDD:409353 | |||
| Ig strand F | 292..297 | CDD:409353 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.910 | |||||