DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr14 and NTM

DIOPT Version :10

Sequence 1:NP_572419.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001338930.1 Gene:NTM / 50863 HGNCID:17941 Length:367 Species:Homo sapiens


Alignment Length:349 Identity:67/349 - (19%)
Similarity:119/349 - (34%) Gaps:128/349 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 FPFFADPYTTLNISTQLSSSVYLHCRVNDLQGKTVSWMRRRGDDLTLITFGQHTYSGDSRYSLEF 136
            ||...|     |::.:...|..|.|.: |.:...|:|:.|.    |::..|...:..|.|..|..
Human    38 FPKAMD-----NVTVRQGESATLRCTI-DNRVTRVAWLNRS----TILYAGNDKWCLDPRVVLLS 92

  Fly   137 EEPNDWKLLIQFANERDEGPYEC--QVSSHPPLVLLVYLTIIVPH-VEILDERGSATPEKYYKAG 198
            .....:.:.||..:..|||||.|  |..:||....:..:..:.|. |||       :.:.....|
Human    93 NTQTQYSIEIQNVDVYDEGPYTCSVQTDNHPKTSRVHLIVQVSPKIVEI-------SSDISINEG 150

  Fly   199 STIELQCVISKIPHPSSYITWRH-GPRLL--------------------NYDTS----------- 231
            :.|.|.|:.:..|.|:  :|||| .|:.:                    :|:.|           
Human   151 NNISLTCIATGRPEPT--VTWRHISPKAVGFVSEDEYLEIQGITREQSGDYECSASNDVAAPVVR 213

  Fly   232 ------------------------RGGISVKTDMLPGRA------------------------LS 248
                                    :|.:..:...:|...                        ||
Human   214 RVKVTVNYPPYISEAKGTGVPVGQKGTLQCEASAVPSAEFQWYKDDKRLIEGKKGVKVENRPFLS 278

  Fly   249 RLYIANANRQDTGNYTCMLGNEITET---VVVHVLNGEEP---------------------AAMQ 289
            :|...|.:..|.|||||:..|::..|   :::..||  ||                     |..:
Human   279 KLIFFNVSEHDYGNYTCVASNKLGHTNASIMLFELN--EPTSSTLLQEVKTTALTPWKGPGAVSE 341

  Fly   290 HANGSRQKANASTMVVLFLVYVCI 313
            .:||:.::|....::.|.::::.:
Human   342 VSNGTSRRAGCVWLLPLLVLHLLL 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr14NP_572419.1 Ig 81..175 CDD:472250 24/95 (25%)
Ig strand B 92..96 CDD:409353 1/3 (33%)
Ig strand C 105..109 CDD:409353 1/3 (33%)
Ig strand E 142..146 CDD:409353 0/3 (0%)
Ig strand F 156..161 CDD:409353 3/6 (50%)
Ig strand G 168..171 CDD:409353 0/2 (0%)
IG_like 191..279 CDD:214653 27/170 (16%)
Ig strand B 201..205 CDD:409473 2/3 (67%)
Ig strand C 214..220 CDD:409473 1/5 (20%)
Ig strand E 248..252 CDD:409473 2/3 (67%)
Ig strand F 262..267 CDD:409473 4/4 (100%)
NTMNP_001338930.1 Ig 44..132 CDD:472250 24/92 (26%)
Ig strand B 53..57 CDD:409353 1/3 (33%)
Ig strand C 65..69 CDD:409353 1/3 (33%)
Ig strand E 98..102 CDD:409353 0/3 (0%)
Ig strand F 112..117 CDD:409353 3/4 (75%)
Ig strand G 125..128 CDD:409353 0/2 (0%)
Ig_3 136..205 CDD:464046 17/77 (22%)
Ig 223..307 CDD:472250 14/83 (17%)
Ig strand B 239..243 CDD:409353 1/3 (33%)
Ig strand C 252..256 CDD:409353 0/3 (0%)
Ig strand E 278..282 CDD:409353 2/3 (67%)
Ig strand F 292..297 CDD:409353 4/4 (100%)

Return to query results.
Submit another query.