DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr14 and dpr12

DIOPT Version :9

Sequence 1:NP_001245573.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_652462.3 Gene:dpr12 / 50320 FlyBaseID:FBgn0085414 Length:326 Species:Drosophila melanogaster


Alignment Length:286 Identity:96/286 - (33%)
Similarity:140/286 - (48%) Gaps:30/286 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 STTLKRPRAGDPFDTFPKNFWQEFSSPFTDTPEDEELEVTETTTHEPFPFFAD-PYTTLNISTQL 88
            :|||:..:.....|...|..|.. .....|:..|..|:.:::      |.|.| .....|.:.||
  Fly    34 ATTLEPDQKSILTDNDWKKLWMR-GGINGDSKLDNNLDSSDS------PMFEDSELMAHNTTVQL 91

  Fly    89 SSSVYLHCRVN--DLQG---KTVSWMRRRGDDLTLITFGQHTYSGDSRYS-LEFEEPNDWKLLIQ 147
            ..:.:|.|:|:  |..|   ..:||:|||  |..:::.|...|:.|.|:: |.....|.|.|.|:
  Fly    92 GGTAFLVCKVSGVDRVGVNWNQISWIRRR--DWHILSSGAQLYTNDERFAILHTPGSNMWTLQIK 154

  Fly   148 FANERDEGPYECQVSSHPPLVL-LVYLTIIVPHVEILDERGSATPEKYYKAGSTIELQCVISKIP 211
            |...||.|.||||||:...::. .|.|.::||...||   ||.  |.:...||||.|.|:|.|.|
  Fly   155 FVQRRDHGMYECQVSTPTGIISHFVNLQVVVPEAFIL---GSG--ELHVDMGSTINLVCIIEKSP 214

  Fly   212 HPSSYITWRHGPRLLNYDTSRGGISVKTDMLPG-RALSRLYIANANRQDTGNYTCMLGNEITETV 275
            .|..|:.|:...||:||..||..|:::|  .|| |..|||.|......|:|||||...|....::
  Fly   215 TPPQYVYWQKNDRLINYVDSRRDITIET--TPGPRTQSRLIIREPQVTDSGNYTCSASNTEPASI 277

  Fly   276 VVHVLNGEEPAAMQHANGSRQKANAS 301
            .|.|..|:..||:     ||:|.:::
  Fly   278 YVFVSKGDNMAAI-----SRRKTSSA 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr14NP_001245573.1 IG_like 83..163 CDD:214653 32/85 (38%)
Ig 84..169 CDD:299845 32/90 (36%)
IG_like 191..279 CDD:214653 36/88 (41%)
Ig 201..274 CDD:143165 31/73 (42%)
dpr12NP_652462.3 IG 86..183 CDD:214652 35/98 (36%)
Ig_3 193..271 CDD:404760 35/81 (43%)
Ig strand B 204..208 CDD:409353 2/3 (67%)
Ig strand C 219..223 CDD:409353 1/3 (33%)
Ig strand E 250..254 CDD:409353 3/3 (100%)
Ig strand F 264..269 CDD:409353 4/4 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I3769
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X190
76.960

Return to query results.
Submit another query.