DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr14 and tutl

DIOPT Version :9

Sequence 1:NP_001245573.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001303307.1 Gene:tutl / 46015 FlyBaseID:FBgn0010473 Length:1536 Species:Drosophila melanogaster


Alignment Length:430 Identity:82/430 - (19%)
Similarity:126/430 - (29%) Gaps:170/430 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 IIYSSLHHIGSGSTSTTLKRPRAGDPFDTFPKNFWQEFSSPFTDTP------EDEELEVTETTTH 69
            |||.:|      ..|..|.....|.|   .|:..|.:.::|...:|      :..||.:: |..|
  Fly   262 IIYVNL------GDSIILNCQADGTP---TPEILWYKDANPVDPSPTVGIFNDGTELRIS-TIRH 316

  Fly    70 EPFPFFADPYTTL--NISTQLS-------------------------SSVYLHCRVNDLQGK-TV 106
            |..    ..||.:  |...|:|                         ..|...|....:.|. ||
  Fly   317 EDI----GEYTCIARNGEGQVSHTARVIIAGGAVIMVPPTNQTKLEGEKVIFSCEAKAMPGNVTV 377

  Fly   107 SWMRRRGDDLTLITFGQHTYSGDSRYSLEFEEPNDWKLLIQFANERDEGPYECQVSS--HPPLVL 169
            .|. |.|..:      :...:.::|.::.    .|..|:|......|.|.|.|:|::  ..|...
  Fly   378 RWY-REGSPV------REVAALETRVTIR----KDGSLIINPIKPDDSGQYLCEVTNGIGDPQSA 431

  Fly   170 LVYLTIIVPHVEILDERGSATPEKYY----KAGSTIELQCVISKIPHPSSYITWRHGPRLLN--- 227
            ..||::..|      .:.:.||...|    .||   .:||.|...|. ..|:||....|||.   
  Fly   432 SAYLSVEYP------AKVTFTPTVQYLPFRLAG---VVQCYIKSSPQ-LQYVTWTKDKRLLEPYQ 486

  Fly   228 -----------------------------------------------------------YDTSRG 233
                                                                       |....|
  Fly   487 MKDIVVMANGSLLFTRVNEEHQGQYACTPYNAQGTAGASGVMDVLVRKPPAFTVEPETLYQRKVG 551

  Fly   234 -GISVKTDMLPGRALSR---------------------------LYIANANRQDTGNYTCMLGNE 270
             .:.:..|.|......|                           :.|.|..|:|.|.|.|::.||
  Fly   552 DSVEMHCDALEAEGTERPTIKWQRQEGEQLTESQRNRIKISGGNITIENLRREDFGYYQCVVSNE 616

  Fly   271 ITETVVVH--VLNGEEPAAMQHANGSRQKANASTMVVLFL 308
            :...:.|.  |:.|.:|.|..:..|   ||..|::.:.:|
  Fly   617 VATLMAVTQLVIEGTQPHAPYNITG---KATESSITLQWL 653

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr14NP_001245573.1 IG_like 83..163 CDD:214653 20/105 (19%)
Ig 84..169 CDD:299845 20/112 (18%)
IG_like 191..279 CDD:214653 29/183 (16%)
Ig 201..274 CDD:143165 24/162 (15%)
tutlNP_001303307.1 V-set 137..250 CDD:284989
IG_like 137..229 CDD:214653
I-set 253..341 CDD:254352 22/92 (24%)
IGc2 268..331 CDD:197706 16/70 (23%)
I-set 346..437 CDD:254352 20/101 (20%)
Ig 349..437 CDD:299845 20/98 (20%)
Ig 459..530 CDD:299845 10/71 (14%)
IG_like 549..628 CDD:214653 14/78 (18%)
IGc2 551..617 CDD:197706 12/65 (18%)
FN3 633..725 CDD:238020 7/24 (29%)
FN3 786..874 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.