DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr14 and LOC4578098

DIOPT Version :10

Sequence 1:NP_572419.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster
Sequence 2:XP_061514183.1 Gene:LOC4578098 / 4578098 VectorBaseID:AGAMI1_004209 Length:452 Species:Anopheles gambiae


Alignment Length:122 Identity:22/122 - (18%)
Similarity:42/122 - (34%) Gaps:45/122 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TEEWLQFEGETQDVCGFISIFTNLFLIYLILKRSP---------DALGLYK-------------- 44
            |....:...:...:.|.||:.::..::|   :|.|         :|:.|:|              
Mosquito   297 TSRIFKISTDPSQLLGMISMLSSFGIVY---ERPPLHFYHEEISNAIALWKSDPLSRCCDVYMRR 358

  Fly    45 --------WLMMYTSIFELTYSFVNLFAG---CSVRTFGSAFIVFRKDQHFHLISQF 90
                    |:.:..||.|   |.::.:..   .|..|...:|:|     |..|:..|
Mosquito   359 PHDVSSESWIKLAGSIDE---SRIDPYTDEVLVSQITIKHSFLV-----HIDLVFHF 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr14NP_572419.1 Ig 81..175 CDD:472250 3/10 (30%)
Ig strand B 92..96 CDD:409353
Ig strand C 105..109 CDD:409353
Ig strand E 142..146 CDD:409353
Ig strand F 156..161 CDD:409353
Ig strand G 168..171 CDD:409353
IG_like 191..279 CDD:214653
Ig strand B 201..205 CDD:409473
Ig strand C 214..220 CDD:409473
Ig strand E 248..252 CDD:409473
Ig strand F 262..267 CDD:409473
LOC4578098XP_061514183.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.