DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr14 and opcml

DIOPT Version :9

Sequence 1:NP_001245573.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001005580.1 Gene:opcml / 449538 ZFINID:ZDB-GENE-040927-3 Length:342 Species:Danio rerio


Alignment Length:314 Identity:69/314 - (21%)
Similarity:111/314 - (35%) Gaps:95/314 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 DPYTTLNISTQLSSSVYLHCRVNDLQGKTVSWMRRRGDDLTLITFGQHTYSGDSRYSLEFEEPND 141
            |.|...||:.:...|..|.|.: |.:...|:|:.|    .|::..|...:|.|.|..|.....|:
Zfish    35 DSYLKDNITVRQGDSAVLKCSM-DNKVSRVAWLNR----TTILFTGNEKWSLDPRVVLLNTAVNE 94

  Fly   142 WKLLIQFANERDEGPYECQV-SSHPPLVLLVYLTIIVPHVEILDERGSATPEKYYKAGSTIELQC 205
            :.:.|...|..|||||.|.: ::..|....|:|.:.|| ..|:    :.:.:.....||.:.|.|
Zfish    95 YSIKILNVNLYDEGPYVCSILTNKKPESTKVHLIVQVP-ARIV----NVSTDVSVNEGSNVSLMC 154

  Fly   206 VISKIPHPSSYITWR----HGPRLL-----------------NYD--TS---------------- 231
            :....|.||  |.|:    .|.|::                 :||  ||                
Zfish   155 LAIGRPEPS--ILWKFRSSKGNRIVTEGEYVEMTGITKDMSGSYDCITSNDISPPDVRTVQVTVN 217

  Fly   232 -----------------RGGISVKTDMLP----------GRAL--------------SRLYIANA 255
                             :|.:..:...:|          .|.|              |.|...|.
Zfish   218 YPPVISRARSTGTAVGQKGVLWCEASAVPLADFQWFKGERRILNGFNGVKIENKGKQSMLTFFNV 282

  Fly   256 NRQDTGNYTCMLGNEITETVVVHVLNGEEPAAMQHANGSRQKANASTMVVLFLV 309
            :.:|.|||||:..|.:..|....:|.|  |.|:...|.:......|.:::..|:
Zfish   283 SEEDYGNYTCVAINTLGITNASIILYG--PGAIHDVNNAALSPTCSLLLLTLLL 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr14NP_001245573.1 IG_like 83..163 CDD:214653 24/80 (30%)
Ig 84..169 CDD:299845 24/85 (28%)
IG_like 191..279 CDD:214653 30/167 (18%)
Ig 201..274 CDD:143165 27/152 (18%)
opcmlNP_001005580.1 Ig 41..129 CDD:299845 27/92 (29%)
IG_like 41..129 CDD:214653 27/92 (29%)
IG_like 139..216 CDD:214653 15/78 (19%)
IGc2 146..202 CDD:197706 14/57 (25%)
I-set 219..307 CDD:254352 15/87 (17%)
ig 223..307 CDD:278476 15/83 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.