DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr14 and cadm2

DIOPT Version :10

Sequence 1:NP_572419.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster
Sequence 2:XP_031751706.1 Gene:cadm2 / 448238 XenbaseID:XB-GENE-998536 Length:441 Species:Xenopus tropicalis


Alignment Length:175 Identity:38/175 - (21%)
Similarity:62/175 - (35%) Gaps:33/175 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 SSPFTDTPEDEELEVTETTTHEPFPFFADPYTTLNISTQLSSSVYLHCRVNDLQGKTVSWMRRRG 113
            :||....|...:..||:                 |::.....::.|.|||:.....::.|.....
 Frog    22 ASPRNKKPSQGQFPVTQ-----------------NVTVVEGGTINLTCRVDQNDNTSLQWSNPAQ 69

  Fly   114 DDLTLITFGQHTYSGDSRYSLEFEEPNDWKLLIQFANERDEGPYECQVSSHPPLVLLVYLTII-- 176
            ..|   .|.......|:|..|.....::..:.|...:..|||.|.|.:.:.|......||.::  
 Frog    70 QTL---YFDDKKALRDNRIELVRASWHELSISISDVSLSDEGQYTCSLFTMPVKTSKAYLMVLGV 131

  Fly   177 --VPHVEILDERGSATPEKYYKAGSTIELQCVISKIPHPSSYITW 219
              .||:.     |..:|   ...|.||:|.|. |....|::.|.|
 Frog   132 PENPHIS-----GFTSP---VMEGDTIQLTCK-SSGSKPAADIRW 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr14NP_572419.1 Ig 81..175 CDD:472250 20/93 (22%)
Ig strand B 92..96 CDD:409353 1/3 (33%)
Ig strand C 105..109 CDD:409353 0/3 (0%)
Ig strand E 142..146 CDD:409353 0/3 (0%)
Ig strand F 156..161 CDD:409353 2/4 (50%)
Ig strand G 168..171 CDD:409353 0/2 (0%)
IG_like 191..279 CDD:214653 10/29 (34%)
Ig strand B 201..205 CDD:409473 2/3 (67%)
Ig strand C 214..220 CDD:409473 2/6 (33%)
Ig strand E 248..252 CDD:409473
Ig strand F 262..267 CDD:409473
cadm2XP_031751706.1 IgV_1_Necl-3 34..129 CDD:409498 22/114 (19%)
Ig strand A 34..37 CDD:409498 0/2 (0%)
FR1 35..53 CDD:409498 4/34 (12%)
Ig strand A' 38..44 CDD:409498 1/22 (5%)
Ig strand B 46..54 CDD:409498 2/7 (29%)
CDR1 54..59 CDD:409498 1/4 (25%)
FR2 60..67 CDD:409498 1/6 (17%)
Ig strand C 60..66 CDD:409498 1/5 (20%)
CDR2 68..79 CDD:409498 2/13 (15%)
Ig strand C' 70..74 CDD:409498 1/6 (17%)
Ig strand C' 76..79 CDD:409498 0/2 (0%)
FR3 80..115 CDD:409498 9/34 (26%)
Ig strand D 84..91 CDD:409498 2/6 (33%)
Ig strand E 94..100 CDD:409498 0/5 (0%)
Ig strand F 107..115 CDD:409498 4/7 (57%)
CDR3 116..119 CDD:409498 0/2 (0%)
Ig strand G 119..129 CDD:409498 2/9 (22%)
FR4 121..128 CDD:409498 2/6 (33%)
IgI_2_Necl-3 128..231 CDD:409467 13/49 (27%)
Ig strand A 129..132 CDD:409467 0/2 (0%)
Ig strand A' 135..139 CDD:409467 2/8 (25%)
Ig strand B 148..158 CDD:409467 5/10 (50%)
Ig strand C 161..170 CDD:409467 3/7 (43%)
Ig strand C' 171..174 CDD:409467
Ig strand D 176..183 CDD:409467
Ig strand E 189..199 CDD:409467
Ig strand F 207..215 CDD:409467
Ig strand G 223..230 CDD:409467
Ig_3 235..308 CDD:464046
4.1m 394..412 CDD:128590
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.