| Sequence 1: | NP_572419.1 | Gene: | dpr14 / 31702 | FlyBaseID: | FBgn0029974 | Length: | 340 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_031751706.1 | Gene: | cadm2 / 448238 | XenbaseID: | XB-GENE-998536 | Length: | 441 | Species: | Xenopus tropicalis |
| Alignment Length: | 175 | Identity: | 38/175 - (21%) |
|---|---|---|---|
| Similarity: | 62/175 - (35%) | Gaps: | 33/175 - (18%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 49 SSPFTDTPEDEELEVTETTTHEPFPFFADPYTTLNISTQLSSSVYLHCRVNDLQGKTVSWMRRRG 113
Fly 114 DDLTLITFGQHTYSGDSRYSLEFEEPNDWKLLIQFANERDEGPYECQVSSHPPLVLLVYLTII-- 176
Fly 177 --VPHVEILDERGSATPEKYYKAGSTIELQCVISKIPHPSSYITW 219 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| dpr14 | NP_572419.1 | Ig | 81..175 | CDD:472250 | 20/93 (22%) |
| Ig strand B | 92..96 | CDD:409353 | 1/3 (33%) | ||
| Ig strand C | 105..109 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 142..146 | CDD:409353 | 0/3 (0%) | ||
| Ig strand F | 156..161 | CDD:409353 | 2/4 (50%) | ||
| Ig strand G | 168..171 | CDD:409353 | 0/2 (0%) | ||
| IG_like | 191..279 | CDD:214653 | 10/29 (34%) | ||
| Ig strand B | 201..205 | CDD:409473 | 2/3 (67%) | ||
| Ig strand C | 214..220 | CDD:409473 | 2/6 (33%) | ||
| Ig strand E | 248..252 | CDD:409473 | |||
| Ig strand F | 262..267 | CDD:409473 | |||
| cadm2 | XP_031751706.1 | IgV_1_Necl-3 | 34..129 | CDD:409498 | 22/114 (19%) |
| Ig strand A | 34..37 | CDD:409498 | 0/2 (0%) | ||
| FR1 | 35..53 | CDD:409498 | 4/34 (12%) | ||
| Ig strand A' | 38..44 | CDD:409498 | 1/22 (5%) | ||
| Ig strand B | 46..54 | CDD:409498 | 2/7 (29%) | ||
| CDR1 | 54..59 | CDD:409498 | 1/4 (25%) | ||
| FR2 | 60..67 | CDD:409498 | 1/6 (17%) | ||
| Ig strand C | 60..66 | CDD:409498 | 1/5 (20%) | ||
| CDR2 | 68..79 | CDD:409498 | 2/13 (15%) | ||
| Ig strand C' | 70..74 | CDD:409498 | 1/6 (17%) | ||
| Ig strand C' | 76..79 | CDD:409498 | 0/2 (0%) | ||
| FR3 | 80..115 | CDD:409498 | 9/34 (26%) | ||
| Ig strand D | 84..91 | CDD:409498 | 2/6 (33%) | ||
| Ig strand E | 94..100 | CDD:409498 | 0/5 (0%) | ||
| Ig strand F | 107..115 | CDD:409498 | 4/7 (57%) | ||
| CDR3 | 116..119 | CDD:409498 | 0/2 (0%) | ||
| Ig strand G | 119..129 | CDD:409498 | 2/9 (22%) | ||
| FR4 | 121..128 | CDD:409498 | 2/6 (33%) | ||
| IgI_2_Necl-3 | 128..231 | CDD:409467 | 13/49 (27%) | ||
| Ig strand A | 129..132 | CDD:409467 | 0/2 (0%) | ||
| Ig strand A' | 135..139 | CDD:409467 | 2/8 (25%) | ||
| Ig strand B | 148..158 | CDD:409467 | 5/10 (50%) | ||
| Ig strand C | 161..170 | CDD:409467 | 3/7 (43%) | ||
| Ig strand C' | 171..174 | CDD:409467 | |||
| Ig strand D | 176..183 | CDD:409467 | |||
| Ig strand E | 189..199 | CDD:409467 | |||
| Ig strand F | 207..215 | CDD:409467 | |||
| Ig strand G | 223..230 | CDD:409467 | |||
| Ig_3 | 235..308 | CDD:464046 | |||
| 4.1m | 394..412 | CDD:128590 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||