DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr14 and dpr17

DIOPT Version :9

Sequence 1:NP_001245573.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001287297.1 Gene:dpr17 / 41470 FlyBaseID:FBgn0051361 Length:664 Species:Drosophila melanogaster


Alignment Length:261 Identity:77/261 - (29%)
Similarity:131/261 - (50%) Gaps:32/261 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 LNISTQLSSSVYLHCRVNDLQGKTVSWMRRRGDDLTLITFGQHTYSGDSRYSLEFEEPND--WKL 144
            |||:.|:.:..|:.|:::.|..|.|||:|.|  |..:|:..:.|:..|.|:...::|.:|  |.|
  Fly   413 LNITAQMGNHAYMPCQIHRLSDKPVSWVRMR--DNHIISVDETTFIADERFQSIYQEDHDYTWSL 475

  Fly   145 LIQFANERDEGPYECQVSSHPPLVLLVYLTIIVPHVEILDERGSATPEKYYKAGSTIELQCVISK 209
            .|::....|.|.||||:::.|.|...|:|.|:.|..|::.::     .::.||||.:.|.|::..
  Fly   476 QIKYVEPSDAGWYECQMATEPKLSAKVHLQIVKPKTELIGDQ-----SRFVKAGSKVALHCIVRG 535

  Fly   210 IPHPSSYITWRHGPRLLNYDTSRGGISVKTDM-LPG------RALSRLYIANANRQDTGNYTCML 267
            ...|..||.|..|.:.::....|.|...:.|. :.|      ..:..|.|....::|:|||||..
  Fly   536 TLDPPKYIIWFRGQKKISDSDERTGWYTQLDRNIFGTVGDNQNTIGSLIIPLVRKEDSGNYTCQP 600

  Fly   268 GNEITETVVVHVLNGEEPAAMQHANGSR-QKANASTMVVLFLVYVCISGSISVAGMNRGLGLGQV 331
            .|.::.:|.:|||:||..|:...:..:| .|...||         |.| ::.:.|:     ||.:
  Fly   601 SNSVSVSVDLHVLSGEYSASAIMSTAARTTKGGRST---------CHS-TLGLLGI-----LGLL 650

  Fly   332 W 332
            |
  Fly   651 W 651

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr14NP_001245573.1 IG_like 83..163 CDD:214653 28/81 (35%)
Ig 84..169 CDD:299845 29/86 (34%)
IG_like 191..279 CDD:214653 25/94 (27%)
Ig 201..274 CDD:143165 20/79 (25%)
dpr17NP_001287297.1 IG_like 414..491 CDD:214653 26/78 (33%)
Ig 415..507 CDD:299845 31/93 (33%)
IG_like 521..612 CDD:214653 25/90 (28%)
IGc2 524..605 CDD:197706 22/80 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444680
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.