DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr14 and dpr17

DIOPT Version :10

Sequence 1:NP_572419.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_731670.1 Gene:dpr17 / 41470 FlyBaseID:FBgn0051361 Length:664 Species:Drosophila melanogaster


Alignment Length:261 Identity:77/261 - (29%)
Similarity:131/261 - (50%) Gaps:32/261 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 LNISTQLSSSVYLHCRVNDLQGKTVSWMRRRGDDLTLITFGQHTYSGDSRYSLEFEEPND--WKL 144
            |||:.|:.:..|:.|:::.|..|.|||:|.|  |..:|:..:.|:..|.|:...::|.:|  |.|
  Fly   413 LNITAQMGNHAYMPCQIHRLSDKPVSWVRMR--DNHIISVDETTFIADERFQSIYQEDHDYTWSL 475

  Fly   145 LIQFANERDEGPYECQVSSHPPLVLLVYLTIIVPHVEILDERGSATPEKYYKAGSTIELQCVISK 209
            .|::....|.|.||||:::.|.|...|:|.|:.|..|::.::     .::.||||.:.|.|::..
  Fly   476 QIKYVEPSDAGWYECQMATEPKLSAKVHLQIVKPKTELIGDQ-----SRFVKAGSKVALHCIVRG 535

  Fly   210 IPHPSSYITWRHGPRLLNYDTSRGGISVKTDM-LPG------RALSRLYIANANRQDTGNYTCML 267
            ...|..||.|..|.:.::....|.|...:.|. :.|      ..:..|.|....::|:|||||..
  Fly   536 TLDPPKYIIWFRGQKKISDSDERTGWYTQLDRNIFGTVGDNQNTIGSLIIPLVRKEDSGNYTCQP 600

  Fly   268 GNEITETVVVHVLNGEEPAAMQHANGSR-QKANASTMVVLFLVYVCISGSISVAGMNRGLGLGQV 331
            .|.::.:|.:|||:||..|:...:..:| .|...||         |.| ::.:.|:     ||.:
  Fly   601 SNSVSVSVDLHVLSGEYSASAIMSTAARTTKGGRST---------CHS-TLGLLGI-----LGLL 650

  Fly   332 W 332
            |
  Fly   651 W 651

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr14NP_572419.1 Ig 81..175 CDD:472250 33/94 (35%)
Ig strand B 92..96 CDD:409353 1/3 (33%)
Ig strand C 105..109 CDD:409353 2/3 (67%)
Ig strand E 142..146 CDD:409353 2/3 (67%)
Ig strand F 156..161 CDD:409353 3/4 (75%)
Ig strand G 168..171 CDD:409353 0/2 (0%)
IG_like 191..279 CDD:214653 25/94 (27%)
Ig strand B 201..205 CDD:409473 1/3 (33%)
Ig strand C 214..220 CDD:409473 2/5 (40%)
Ig strand E 248..252 CDD:409473 1/3 (33%)
Ig strand F 262..267 CDD:409473 4/4 (100%)
dpr17NP_731670.1 V-set 415..507 CDD:462230 31/93 (33%)
IG_like 521..612 CDD:214653 25/90 (28%)
Ig strand B 527..531 CDD:409353 1/3 (33%)
Ig strand C 542..546 CDD:409353 2/3 (67%)
Ig strand E 581..585 CDD:409353 1/3 (33%)
Ig strand F 595..600 CDD:409353 4/4 (100%)

Return to query results.
Submit another query.