DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr14 and dpr5

DIOPT Version :9

Sequence 1:NP_001245573.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_650080.3 Gene:dpr5 / 41381 FlyBaseID:FBgn0037908 Length:336 Species:Drosophila melanogaster


Alignment Length:247 Identity:84/247 - (34%)
Similarity:133/247 - (53%) Gaps:12/247 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 PFFADPYTTLNISTQLSSSVYLHCRVNDLQGKTVSWMRRRGDDLTLITFGQHTYSGDSRY-SLEF 136
            |.| |..|...:...|.::..|||||..|..:.|||:|:|  ||.::|.|..||:.|.|: :...
  Fly    90 PVF-DNTTDREVIAALGTTARLHCRVRHLGDRAVSWIRQR--DLHILTIGIMTYTNDQRFLARHI 151

  Fly   137 EEPNDWKLLIQFANERDEGPYECQVSSHPPLVLLVYLTIIVPHVEILDERGSATPEKYYKAGSTI 201
            :..::|.|.|....:||.|.||||||:.|.:.|...|.::....:||..|     |.:.::||.|
  Fly   152 DNSDEWVLKIVSVQQRDAGVYECQVSTEPKISLAYKLVVVTSKAQILANR-----ELFIQSGSDI 211

  Fly   202 ELQCVISKIPHPSSYITWRHGPRLLNYDTSRGGISVKTDMLPGRALSRLYIANANRQDTGNYTCM 266
            .|.|:..:.|.|.:::.|.....|:: |::||||.|:::.  ....|.|.|:.....|:|||||.
  Fly   212 NLTCIAPQAPGPYTHMLWHKDTELVS-DSARGGIRVESEQ--QMKTSNLVISRVQHTDSGNYTCS 273

  Fly   267 LGNEITETVVVHVLNGEEPAAMQHANGSRQKANASTMVVLFLVYVCISGSIS 318
            ..|..:::|.||::..|:.|||||..|||.......:::|.::.|.:.|..|
  Fly   274 ADNSNSDSVFVHIIKSEQHAAMQHELGSRLLLPPLPLLLLAVLLVVLLGPTS 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr14NP_001245573.1 IG_like 83..163 CDD:214653 31/80 (39%)
Ig 84..169 CDD:299845 33/85 (39%)
IG_like 191..279 CDD:214653 28/87 (32%)
Ig 201..274 CDD:143165 23/72 (32%)
dpr5NP_650080.3 V-set 95..191 CDD:284989 36/97 (37%)
IG_like 98..179 CDD:214653 32/82 (39%)
IG_like 206..278 CDD:214653 25/74 (34%)
Ig 211..278 CDD:143165 23/69 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444728
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I3769
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.