DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr14 and Ama

DIOPT Version :10

Sequence 1:NP_572419.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_731114.2 Gene:Ama / 40831 FlyBaseID:FBgn0000071 Length:341 Species:Drosophila melanogaster


Alignment Length:205 Identity:52/205 - (25%)
Similarity:80/205 - (39%) Gaps:43/205 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 NISTQLSSSVYLHCRVNDLQGKTVSWMRR--RGDDLTLITFGQHTYS-GDSRYSLEFEE-PND-- 141
            ::...:..||..:|.|.::...:|||.:|  ..|..:::...::..| .|.||::...| |..  
  Fly    41 DVVASVGDSVEFNCTVEEVGQLSVSWAKRPSESDTNSVVLSMRNILSLPDQRYNVTVTEGPKTGS 105

  Fly   142 --WKLLIQFANERDEGPYECQ--VSSHPPLVLLVYLTIIVPHVEILDERGSATPEKYYKAGSTIE 202
              :...||.....|.||||||  ||:...:...:.|.|..|.| |.:....:|   ....|..:|
  Fly   106 AIYTFRIQNIEVSDMGPYECQVLVSATEKVTKKLSLQI
KTPPV-IAENTPKST---LVTEGQNLE 166

  Fly   203 LQCVISKIPHPSSYITWRH--------GPRLLNYDTSRGGISVKTDMLPGRALSRLYIANANRQD 259
            |.|..:..|.|:  |:|..        |..||...|.|                   |.:.:|.|
  Fly   167 LTCHANGFPKPT--ISWAREHNAVMPAGGHLLAEPTLR-------------------IRSVHRMD 210

  Fly   260 TGNYTCMLGN 269
            .|.|.|:..|
  Fly   211 RGGYYCIAQN 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr14NP_572419.1 Ig 81..175 CDD:472250 27/101 (27%)
Ig strand B 92..96 CDD:409353 1/3 (33%)
Ig strand C 105..109 CDD:409353 2/3 (67%)
Ig strand E 142..146 CDD:409353 0/3 (0%)
Ig strand F 156..161 CDD:409353 5/6 (83%)
Ig strand G 168..171 CDD:409353 0/2 (0%)
IG_like 191..279 CDD:214653 20/87 (23%)
Ig strand B 201..205 CDD:409473 2/3 (67%)
Ig strand C 214..220 CDD:409473 1/5 (20%)
Ig strand E 248..252 CDD:409473 0/3 (0%)
Ig strand F 262..267 CDD:409473 2/4 (50%)
AmaNP_731114.2 I-set 33..143 CDD:400151 27/101 (27%)
Ig strand B 50..54 CDD:409353 1/3 (33%)
Ig strand C 63..68 CDD:409353 3/4 (75%)
Ig strand E 101..112 CDD:409353 1/10 (10%)
Ig strand F 122..127 CDD:409353 4/4 (100%)
Ig strand G 136..139 CDD:409353 0/2 (0%)
Ig_3 146..220 CDD:464046 23/98 (23%)
I-set 254..330 CDD:400151
Ig strand B 255..259 CDD:409353
Ig strand C 268..272 CDD:409353
Ig strand E 298..302 CDD:409353
Ig strand F 312..317 CDD:409353
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.