DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr14 and LSAMP

DIOPT Version :9

Sequence 1:NP_001245573.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001305844.1 Gene:LSAMP / 4045 HGNCID:6705 Length:361 Species:Homo sapiens


Alignment Length:205 Identity:59/205 - (28%)
Similarity:83/205 - (40%) Gaps:37/205 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 TLNISTQLSSSVYLHCRVNDLQGKTVSWMRRRGDDLTLITFGQHTYSGDSRYSLEFEEPNDWKLL 145
            |.||:.:...:..|.|.|.|...| |:|:.|.|    :|..|...:|.|.|..||.....::.|.
Human    38 TDNITVRQGDTAILRCVVEDKNSK-VAWLNRSG----IIFAGHDKWSLDPRVELEKRHSLEYSLR 97

  Fly   146 IQFANERDEGPYECQV-SSHPPLVLLVYLTIIVPHVEILDERGSATPEKYYKAGSTIELQCVISK 209
            ||..:..|||.|.|.| :.|.|....|||.:.||     .:..:.:.:.....||.:.|.|:.:.
Human    98 IQKVDVYDEGSYTCSVQTQHEPKTSQVYLIVQVP-----PKISNISSDVTVNEGSNVTLVCMANG 157

  Fly   210 IPHPSSYITWRHGPRLLNYDTSRGGISVKTDMLP-GRAL----SRLYIANANRQDTGNYTCMLGN 269
            .|.|  .|||||                   :.| ||..    ..|.|....|:.:|.|.|...|
Human   158 RPEP--VITWRH-------------------LTPTGREFEGEEEYLEILGITREQSGKYECKAAN 201

  Fly   270 EITETVVVHV 279
            |::...|..|
Human   202 EVSSADVKQV 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr14NP_001245573.1 IG_like 83..163 CDD:214653 27/80 (34%)
Ig 84..169 CDD:299845 28/85 (33%)
IG_like 191..279 CDD:214653 23/92 (25%)
Ig 201..274 CDD:143165 20/77 (26%)
LSAMPNP_001305844.1 Ig 38..128 CDD:386229 33/94 (35%)
Ig 132..215 CDD:386229 24/101 (24%)
Ig_3 219..294 CDD:372822
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.