DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr14 and CG7166

DIOPT Version :10

Sequence 1:NP_572419.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_649339.2 Gene:CG7166 / 40401 FlyBaseID:FBgn0037107 Length:467 Species:Drosophila melanogaster


Alignment Length:261 Identity:58/261 - (22%)
Similarity:92/261 - (35%) Gaps:66/261 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 TFPKNFWQ---------------EFSSPFTDTPEDEELEVTETTTHEPFPFFADPYTTLNISTQL 88
            |:.:.:|.               .|..|..|.|          ||...|......|..:     :
  Fly     3 TYTRKYWTLVLYLFSFSLSLIGGSFILPENDPP----------TTAPKFLSRGHLYKVI-----V 52

  Fly    89 SSSVYLHCRVNDLQGKTVSWMRRRGDDLTLITFGQHTYSGDSRYSLEFEEPNDWKLLIQFANERD 153
            ..::.|.|:|.:|....:.|  |:|.  :::|.|....:.|.|:.:    ..|:.|.|.....:|
  Fly    53 GETIELPCKVQNLGSFVLLW--RKGS--SVLTAGHLKITRDQRFKI----VGDYNLQINGVKTQD 109

  Fly   154 EGPYECQVSSHPPLVLLVYLTIIV-PHVEILDERGSATPEKYYKAGSTIELQCVISKIPHPSSYI 217
            .|.|.||:........:..:.|:| |.:..|...|..|..|    |||:.|:|..|..|.|:  |
  Fly   110 AGDYICQLGDQENRDQVHTVEILVPPTLRALPHNGQVTARK----GSTVTLECKASGNPVPT--I 168

  Fly   218 TWRHGPRLLNYDTSRGGISVKTDMLPGRA----LSRLYIANANRQDTGNYTCMLGNEITETVVVH 278
            .|                 .|.|:..|..    .|.|.:.|.:|...|.|.|...|.:.:.|.:.
  Fly   169 FW-----------------FKKDVFSGPTHLSDSSTLILENVDRHHAGTYQCSADNGVKDRVSMD 216

  Fly   279 V 279
            :
  Fly   217 I 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr14NP_572419.1 Ig 81..175 CDD:472250 19/93 (20%)
Ig strand B 92..96 CDD:409353 1/3 (33%)
Ig strand C 105..109 CDD:409353 0/3 (0%)
Ig strand E 142..146 CDD:409353 1/3 (33%)
Ig strand F 156..161 CDD:409353 2/4 (50%)
Ig strand G 168..171 CDD:409353 0/2 (0%)
IG_like 191..279 CDD:214653 23/91 (25%)
Ig strand B 201..205 CDD:409473 1/3 (33%)
Ig strand C 214..220 CDD:409473 1/5 (20%)
Ig strand E 248..252 CDD:409473 2/3 (67%)
Ig strand F 262..267 CDD:409473 2/4 (50%)
CG7166NP_649339.2 IG_like 50..133 CDD:214653 20/95 (21%)
Ig strand B 56..60 CDD:409353 1/3 (33%)
Ig strand C 69..73 CDD:409353 1/5 (20%)
Ig strand E 98..102 CDD:409353 1/3 (33%)
Ig strand F 112..116 CDD:409353 1/3 (33%)
Ig_3 134..207 CDD:464046 25/95 (26%)
Ig_3 224..301 CDD:464046
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.