DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr14 and dpr10

DIOPT Version :9

Sequence 1:NP_001245573.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_729591.1 Gene:dpr10 / 39180 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster


Alignment Length:309 Identity:93/309 - (30%)
Similarity:138/309 - (44%) Gaps:71/309 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 THEP---FPF---FADPYTTL----NISTQLSSSVYLHCRVNDLQGKTVSWMRRRGDDLTLITFG 122
            ||.|   :|.   :.:||..|    ||::.:..|.||.|||..|..|||:|:|.|  ||.::|.|
  Fly    37 THAPPSHYPHGHKWNEPYFDLTMPRNITSLVGKSAYLGCRVKHLGNKTVAWIRHR--DLHILTVG 99

  Fly   123 QHTYSGDSRYSLEF-EEPNDWKLLIQFANERDEGPYECQVSSHPPLVLLVYLTIIVPHVEILDER 186
            .:||:.|.|:...: .:.::|.|.|::|.:||.|.||||:|:.|.....|.|.|    |:::|..
  Fly   100 TYTYTTDQRFQTSYHRDIDEWTLQIKWAQQRDAGVYECQISTQPVRSYSVNLNI----VDLIDAE 160

  Fly   187 GSATPEKYYK---------------------------------------------AGSTIELQCV 206
            .|...::||.                                             .||||.|.|:
  Fly   161 TSDIMQQYYNDDAFYIAENRVYQSSNDEFAGMFGPIQTVAVPTATILGGPDLYVDKGSTINLTCI 225

  Fly   207 ISKIPHPSSYITWRHGPRLLNYDTSRGGISVKTDMLPGRALSRLYIANANRQDTGNYTCMLGNEI 271
            |...|.|.::|.|.|..::|:.:||.|.:..|| :......|.|.|.:|:...:|.|:|...|..
  Fly   226 IKFSPEPPTHIFWYHQDKVLSEETSGGRLKFKT-IKSEETKSILLIYDADLLHSGKYSCYPSNTE 289

  Fly   272 TETVVVHVLNGEEPAAMQHANGSRQKANASTMVVLFLVYVCISGSISVA 320
            ..::.||||.||.|.|||        .||:...|....:.|..|..:.|
  Fly   290 IASIRVHVLQGERPEAMQ--------TNAAPAAVALACWSCHFGQATQA 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr14NP_001245573.1 IG_like 83..163 CDD:214653 34/80 (43%)
Ig 84..169 CDD:299845 35/85 (41%)
IG_like 191..279 CDD:214653 29/132 (22%)
Ig 201..274 CDD:143165 23/72 (32%)
dpr10NP_729591.1 Ig 63..143 CDD:299845 34/81 (42%)
IG_like 210..297 CDD:214653 27/87 (31%)
IGc2 217..287 CDD:197706 25/70 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444671
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I3769
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.