DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr14 and Dscam2

DIOPT Version :9

Sequence 1:NP_001245573.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001261500.1 Gene:Dscam2 / 38788 FlyBaseID:FBgn0265296 Length:2101 Species:Drosophila melanogaster


Alignment Length:283 Identity:62/283 - (21%)
Similarity:98/283 - (34%) Gaps:78/283 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 LNISTQLSSSVYLHCRVNDLQGKTVSWMRRRGDDLTLITFGQHTYSGDSRYSLEFEEP-----ND 141
            ::.:.:.:..:.|||:...:...::.|.:..|             |....|....|.|     .:
  Fly   715 VDANVERNRHIMLHCQAQGVPTPSIVWKKATG-------------SKSGEYEEVRERPFTKLLGN 766

  Fly   142 WKLLIQFANERDEGPYECQ----------------VSSHPPLVLLVYLTIIVPHVEILDERGSAT 190
            ..||:|...|..||.|.||                |:|.|      |.:             |.:
  Fly   767 GSLLLQHVKEDREGFYLCQANNGIGTGIGKVIQLKVNSSP------YFS-------------STS 812

  Fly   191 PEKYYKAGSTIELQCVISKIPHPSSYITWRHGPRLLNYDTSRGGISVKTDMLPGRALSRLYIANA 255
            .....|.|.|..|||.:|. ..|.:.:..|.|...||..|:. .||||.:..|....:.|.|...
  Fly   813 RSVMVKKGDTALLQCAVSG-DKPINIVWMRSGKNTLNPSTNY-KISVKQEATPDGVSAELQIRTV 875

  Fly   256 NRQDTGNYTC----MLGNEITETVVVHVLNGEEPAAMQHANGSRQKANASTMVVLFLVYVCISGS 316
            :..|:|.|.|    :.||: .:.|.:.|.....|.::..|          .|:        .|.|
  Fly   876 DATDSGPYFCRASNLYGND-QQLVQLQVQEPPLPPSVLEA----------AMI--------SSRS 921

  Fly   317 ISVAGMNRGLGLGQVWGWGWELR 339
            :::....:.||.|.|..:..|.|
  Fly   922 VNIKWQPKTLGTGDVTKYIVEFR 944

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr14NP_001245573.1 IG_like 83..163 CDD:214653 19/100 (19%)
Ig 84..169 CDD:299845 21/105 (20%)
IG_like 191..279 CDD:214653 27/91 (30%)
Ig 201..274 CDD:143165 23/76 (30%)
Dscam2NP_001261500.1 Ig 51..127 CDD:299845
Ig 138..>203 CDD:299845
I-set 238..327 CDD:254352
Ig 247..327 CDD:299845
I-set 332..418 CDD:254352
IGc2 344..407 CDD:197706
IG_like 432..517 CDD:214653
IGc2 436..507 CDD:197706
I-set 521..610 CDD:254352
IGc2 533..597 CDD:197706
Ig 630..699 CDD:143165
IG_like 714..802 CDD:214653 18/99 (18%)
Ig 725..802 CDD:299845 18/89 (20%)
Ig 823..894 CDD:143165 22/72 (31%)
FN3 906..1006 CDD:238020 11/57 (19%)
FN3 1013..1111 CDD:238020
FN3 1119..1209 CDD:238020
FN3 1219..1313 CDD:238020
Ig 1336..1402 CDD:143165
FN3 1409..1498 CDD:238020
FN3 1515..1588 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.