DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr14 and ImpL2

DIOPT Version :9

Sequence 1:NP_001245573.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_728961.2 Gene:ImpL2 / 38513 FlyBaseID:FBgn0001257 Length:267 Species:Drosophila melanogaster


Alignment Length:316 Identity:69/316 - (21%)
Similarity:104/316 - (32%) Gaps:119/316 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 GSTSTTLKRPRAGDPFD---TFPKNFWQEFSSPFTDTPEDEELEVTETTTHEPFPFFADPYTTLN 83
            ||.:|.  |.||.|..|   ....:...|...|.....|.:.|:.|:|           |.|.|.
  Fly    18 GSIATV--RGRAVDLVDDSNDVDNSIEAEEEKPRNRAFEADWLKFTKT-----------PPTKLQ 69

  Fly    84 ISTQLSSSVYLHCRVNDLQGKTVSWM-----RRRGDDLTLITFGQHTYSGDSRYSLEFEEPNDWK 143
            .:.  .:::.:.|.:...|..::.|:     |...|||            ||....| |.|:   
  Fly    70 QAD--GATIEIVCEMMGSQVPSIQWVVGHLPRSELDDL------------DSNQVAE-EAPS--- 116

  Fly   144 LLIQFANER-------DEGPYEC-----------QVSSHPPLVLLVYLTIIVPHVEILDERGS-A 189
            .:::..:..       :...|.|           ....|||                   |.| .
  Fly   117 AIVRVRSSHIIDHVLSEARTYTCVGRTGSKTIYASTVVHPP-------------------RSSRL 162

  Fly   190 TPEKYYKA-----------------GSTIELQCVISKIPHPSSYITWRHGPRLLNYDTSRGGISV 237
            ||||.|..                 ||.|:|.|.:.  ..|.:.|||      ||.:..      
  Fly   163 TPEKTYPGAQKPRIIYTEKTHLDLMGSNIQLPCRVH--ARPRAEITW------LNNENK------ 213

  Fly   238 KTDMLPG---RALSR--LYIANANRQDTGNYTC----MLGNEITETVVVHVLNGEE 284
              :::.|   |.|:.  |.|:....:|.|||.|    ::|.:..:|.|..|||.|:
  Fly   214 --EIVQGHRHRVLANGDLLISEIKWEDMGNYKCIARNVVGKDTADTFVYPVLNEED 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr14NP_001245573.1 IG_like 83..163 CDD:214653 14/102 (14%)
Ig 84..169 CDD:299845 17/107 (16%)
IG_like 191..279 CDD:214653 28/113 (25%)
Ig 201..274 CDD:143165 20/81 (25%)
ImpL2NP_728961.2 IGc2 187..251 CDD:197706 21/79 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.