DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr14 and Gm1123

DIOPT Version :10

Sequence 1:NP_572419.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001074245.1 Gene:Gm1123 / 382097 MGIID:2685969 Length:390 Species:Mus musculus


Alignment Length:253 Identity:59/253 - (23%)
Similarity:86/253 - (33%) Gaps:72/253 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 TPEDEELEVTETTTHEP--FPFFADPYTTLNISTQLSSSVYLHCRVNDLQGKTVSWMRRRGDDLT 117
            |||....:....|.|.|  |.|.:.....|||                      .|:|..|.:..
Mouse   149 TPEQTIEKDQGETVHLPCMFTFISKDQGPLNI----------------------EWLRLSGPNNE 191

  Fly   118 LITFGQHTYSGDSRYSLEFEE--------PNDWK---LLIQFANER--DEGPYECQVSSHPPLVL 169
            .:......||.|..:...:.:        .||.|   ..|...|.:  |.|.|:|:|.::|..|.
Mouse   192 AMDHVVILYSADKIHDDVYPDLKGRVYFTSNDIKSGDASINITNVQLSDAGTYQCKVKTYPGTVN 256

  Fly   170 LVYLTIIVPHVEILDERGS---ATPEK-YYKA-GSTIELQCVISKIP--HPSSYITWRH--GPR- 224
            ......:..|:      ||   .|||: ..|| |.|:.|.|..:..|  |...:|.|..  ||: 
Mouse   257 RNLQLAVTDHI------GSVSITTPEQTIQKARGETVHLPCTFTLSPEDHGPLFIDWMQLTGPQN 315

  Fly   225 -LLN---------------YDTSRGGIS-VKTDMLPGRALSRLYIANANRQDTGNYTC 265
             ::|               |...:|.:. ...|:..|.|  .:.|.:|...|.|.|.|
Mouse   316 EVVNRMFIVYLADKIYDNFYQDMKGRVQFTSNDIRSGEA--SINITDARLSDAGTYQC 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr14NP_572419.1 Ig 81..175 CDD:472250 21/106 (20%)
Ig strand B 92..96 CDD:409353 0/3 (0%)
Ig strand C 105..109 CDD:409353 0/3 (0%)
Ig strand E 142..146 CDD:409353 1/6 (17%)
Ig strand F 156..161 CDD:409353 2/4 (50%)
Ig strand G 168..171 CDD:409353 1/2 (50%)
IG_like 191..279 CDD:214653 26/99 (26%)
Ig strand B 201..205 CDD:409473 1/3 (33%)
Ig strand C 214..220 CDD:409473 1/5 (20%)
Ig strand E 248..252 CDD:409473 0/3 (0%)
Ig strand F 262..267 CDD:409473 2/4 (50%)
Gm1123NP_001074245.1 Ig 20..137 CDD:472250
Ig strand B 37..41 CDD:409353
Ig strand C 54..58 CDD:409353
Ig strand E 104..108 CDD:409353
Ig strand F 118..123 CDD:409353
Ig strand G 131..134 CDD:409353
Ig 145..261 CDD:472250 29/133 (22%)
Ig strand B 162..166 CDD:409353 1/3 (33%)
Ig strand C 179..183 CDD:409353 2/25 (8%)
Ig strand E 229..233 CDD:409353 1/3 (33%)
Ig strand F 243..248 CDD:409353 2/4 (50%)
Ig strand G 256..259 CDD:409353 0/2 (0%)
Ig 270..387 CDD:472250 27/104 (26%)
Ig strand B 287..291 CDD:409353 1/3 (33%)
Ig strand C 304..308 CDD:409353 1/3 (33%)
Ig strand E 354..358 CDD:409353 1/5 (20%)
Ig strand F 368..373 CDD:409353 2/4 (50%)
Ig strand G 381..384 CDD:409353
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.