DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr14 and dpr20

DIOPT Version :9

Sequence 1:NP_001245573.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_612066.1 Gene:dpr20 / 38101 FlyBaseID:FBgn0035170 Length:525 Species:Drosophila melanogaster


Alignment Length:321 Identity:114/321 - (35%)
Similarity:169/321 - (52%) Gaps:36/321 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 AIIYSSLHHIGSGSTSTTLKRPRAGDPFDTFPK-----NFWQEFSSPFTDTPEDEELEVTETTTH 69
            |:...|.|.:..|..:..   |.....||||..     :..|.:...|.|..     .:.:.|  
  Fly   223 AVKVDSKHPLSKGQKTDA---PMLNYIFDTFSSANKHHHHDQRYGPHFEDVQ-----RIGQAT-- 277

  Fly    70 EPFPFFADPYTTLNISTQLSSSVYLHCRVNDLQGKTVSWMRR--------RGDDLTLITFGQHTY 126
                         |::.|..||::|:||::.||.|||||:|.        .|:.|.|:|.|.|||
  Fly   278 -------------NLTVQAGSSIHLNCRISLLQDKTVSWVRHNTQDEGKDNGNALDLLTVGMHTY 329

  Fly   127 SGDSRYSLEFEEPNDWKLLIQFANERDEGPYECQVSSHPPLVLLVYLTIIVPHVEILDERGSATP 191
            :||.||.:||:.||:|:|.|....:.||..||||:|:|||.|:.:.|.:..|.|.|:||.|....
  Fly   330 TGDKRYKMEFQYPNNWRLKITNVKKDDEAIYECQISTHPPRVIQINLHVNAPKVMIVDEVGDPLQ 394

  Fly   192 EKYYKAGSTIELQCVISKIPHPSSYITWRHGPRLLNYDTSRGGISVKTDMLPGRALSRLYIANAN 256
            ||||:..||::|.||:..:...||.:.|:|...:||||.:|||:||||:::...|.|.|.||..:
  Fly   395 EKYYEIDSTLQLSCVVRNVAMTSSVVFWKHMDNILNYDVTRGGVSVKTELMEDGANSTLSIAKIS 459

  Fly   257 RQDTGNYTCMLGNEITETVVVHVLNGEEPAAMQHANGSRQKANASTMVVLFLVYVCISGSI 317
            :.|:|||||.:......|:|||:||||..|.:.|.......:....||:|..:.:.:..|:
  Fly   460 KTDSGNYTCSISEFQNFTIVVHILNGESFAELHHGGAVGWHSTWWNMVMLHAMALLVLNSL 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr14NP_001245573.1 IG_like 83..163 CDD:214653 40/87 (46%)
Ig 84..169 CDD:299845 43/92 (47%)
IG_like 191..279 CDD:214653 38/87 (44%)
Ig 201..274 CDD:143165 29/72 (40%)
dpr20NP_612066.1 IG_like 278..365 CDD:214653 40/86 (47%)
Ig 279..378 CDD:299845 45/98 (46%)
Ig 400..471 CDD:299845 31/70 (44%)
IG_like 402..480 CDD:214653 32/77 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444781
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303091at33208
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.