DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr14 and CG13506

DIOPT Version :9

Sequence 1:NP_001245573.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001286718.1 Gene:CG13506 / 37556 FlyBaseID:FBgn0034723 Length:503 Species:Drosophila melanogaster


Alignment Length:351 Identity:75/351 - (21%)
Similarity:118/351 - (33%) Gaps:117/351 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 AGDPFDTFPKNF-WQEFSSPFTDTPEDEELEVTETTTH----EPFPFFADPYTTLNISTQLSSSV 92
            ||.|.|...|.. :|:....:.|..:|::.::.:.|.:    |..|:|  ..|.|.:..:....|
  Fly    25 AGSPIDADVKGTDYQDDEYEYGDDTDDDDTQIIDVTKNHAEQEAPPYF--DVTDLRVEAKPGDDV 87

  Fly    93 YLHCRVNDLQ-GKTVSWMRRR-------------------------------GDD---------- 115
            .|:|...:.| ...|.|.:.|                               .||          
  Fly    88 ILNCDARNFQLSNAVVWYKNRIIIANGQNPISQRVQCMLNNSILLRNVSPEDSDDYYCEILPQRV 152

  Fly   116 -----------LTLI-----------TF--GQH------TYSGDS---RYSLEFEEPN------- 140
                       |:::           ||  |.|      ||..|:   ::|  |.:.|       
  Fly   153 RQHTALRVGARLSILCDDRDITDRSQTFRQGDHHKLECRTYLPDNATIKWS--FNDLNGQPSSVD 215

  Fly   141 --DWKLLIQFANERDEGPYECQV---SSHPP----LVLLVYLTIIVPHVEILDERGSATPEKYYK 196
              :..:::...:|::.|.|:|..   |.|||    .:.:.|..|:..|      |.:...||   
  Fly   216 NQNGVIILDNVDEKNAGDYQCLADDGSRHPPHGTVHIDVQYSPIVSTH------RHNVNTEK--- 271

  Fly   197 AGSTIELQCVISKIPHPSSYITWRHGPRLLNYDTSRGGISVKTDMLPGRALSRLYIANANRQDTG 261
             |:|.||.|.....|...||.. :.|..|...|.    .|:|..:......:.|.:......|.|
  Fly   272 -GATAELYCNYRAKPIGRSYFI-KDGKTLQLSDK----YSLKDSVHNDHNRTTLIVREVTDSDLG 330

  Fly   262 NYTCMLGNEI-TETVVVHV-LNGEEP 285
            .|.|.:.|.| :..|.||| .|.|.|
  Fly   331 EYLCQVENAIGSNEVKVHVSYNPETP 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr14NP_001245573.1 IG_like 83..163 CDD:214653 24/166 (14%)
Ig 84..169 CDD:299845 28/175 (16%)
IG_like 191..279 CDD:214653 24/88 (27%)
Ig 201..274 CDD:143165 18/73 (25%)
CG13506NP_001286718.1 IG_like 79..146 CDD:214653 9/66 (14%)
IGc2 83..146 CDD:197706 9/62 (15%)
IG_like 176..254 CDD:214653 18/79 (23%)
Ig 176..239 CDD:299845 14/64 (22%)
I-set 258..349 CDD:254352 27/105 (26%)
Ig 275..348 CDD:143165 19/77 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.