DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr14 and wrapper

DIOPT Version :9

Sequence 1:NP_001245573.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_477404.1 Gene:wrapper / 37555 FlyBaseID:FBgn0025878 Length:500 Species:Drosophila melanogaster


Alignment Length:216 Identity:51/216 - (23%)
Similarity:84/216 - (38%) Gaps:41/216 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 ISTQLSSSVYLHCRVNDLQGKTVSWMRRRGDDLTLITFGQHTYSGDSRYSLEFEEPNDWKL---- 144
            :.|..:.:|.|.|.:| ...:.|.|.|   ||:.|:         |||:. |...|:...|    
  Fly    44 VKTYENDTVQLPCTLN-TPFRYVRWHR---DDVALV---------DSRHP-ELPPPDRIMLWPNG 94

  Fly   145 LIQFAN--ERDEGPYECQVSSHPPLVLLVYLTIIVPHVEILDERGSATPEKYYKAGSTIELQCVI 207
            .:|.||  ..|.|.|.|:::|....|:..:...:....::|.|....|.:   :.|:..|:.|..
  Fly    95 SLQVANVQSSDTGDYYCEMNSDSGHVVQQH
AIEVQLAPQVLIEPSDLTEQ---RIGAIFEVVCEA 156

  Fly   208 SKIPHPSSYITWRHGPRLLNYDTSRGGISVKTDMLPGRALSRLYIANANRQDTGNYTCMLGNEIT 272
            ..:|.|  .||||....::...::.|.            ...|.:...:|...|...|:..|.:.
  Fly   157 QGVPQP--VITWRLNGNVIQPQSNTGN------------RQSLILEIKSRNQAGLIECVASNGVG 207

  Fly   273 E----TVVVHVLNGEEPAAMQ 289
            |    .|.:|||...|.:..|
  Fly   208 EPAVANVYLHVLFSPEVSIPQ 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr14NP_001245573.1 IG_like 83..163 CDD:214653 24/84 (29%)
Ig 84..169 CDD:299845 25/90 (28%)
IG_like 191..279 CDD:214653 17/91 (19%)
Ig 201..274 CDD:143165 15/76 (20%)
wrapperNP_477404.1 Ig 41..124 CDD:299845 26/93 (28%)
IG_like 41..118 CDD:214653 25/87 (29%)
IG_like 145..218 CDD:214653 17/86 (20%)
Ig 147..219 CDD:299845 18/85 (21%)
I-set 224..323 CDD:254352 1/5 (20%)
IGc2 236..314 CDD:197706
FN3 339..431 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.