DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr14 and Lac

DIOPT Version :9

Sequence 1:NP_001245573.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_523713.2 Gene:Lac / 36363 FlyBaseID:FBgn0010238 Length:359 Species:Drosophila melanogaster


Alignment Length:205 Identity:55/205 - (26%)
Similarity:86/205 - (41%) Gaps:35/205 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 YTTLNISTQLSSSVYLHCRVNDLQGKTVSWMRRRGDDLTLITFGQHTYSGDSRYSLEFEEPND-- 141
            |.|......:..:|...|.|...:...|.:::...|.:.|.| |......|||:||.: :||.  
  Fly    33 YITQEQIKDIGGTVEFDCSVQYAKEYNVLFLKTDSDPVFLST-GSTLVIKDSRFSLRY-DPNSST 95

  Fly   142 WKLLIQFANERDEGPYECQV--SSHPPLVLLVYLTIIVPHVEILDERGSATPEKYYKAGSTIELQ 204
            :||.|:...|.|.|.|.|||  |:...:...|.|::..|.| |.|   ::|.......||.::::
  Fly    96 YKLQIKDIQETDAGTYTCQVVISTVHKVSAEVKLSVRRPPV-ISD---NSTQSVVASEGSEVQME 156

  Fly   205 CVISKIPHPSSYITWRHGPRLLNYDTSRGGISVKTDMLPGRALSRLYIAN------ANRQDTGNY 263
            |..|..|.|:  ||||.          .....:.||       |..|:.|      ..::|.|.|
  Fly   157 CYASGYPTPT--ITWRR----------ENNAILPTD-------SATYVGNTLRIKSVKKEDRGTY 202

  Fly   264 TCMLGNEITE 273
            .|:..|.:::
  Fly   203 YCVADNGVSK 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr14NP_001245573.1 IG_like 83..163 CDD:214653 25/83 (30%)
Ig 84..169 CDD:299845 26/88 (30%)
IG_like 191..279 CDD:214653 20/89 (22%)
Ig 201..274 CDD:143165 18/79 (23%)
LacNP_523713.2 IG_like 36..131 CDD:214653 28/96 (29%)
FR1 37..50 CDD:409353 1/12 (8%)
Ig strand A' 37..42 CDD:409353 0/4 (0%)
Ig strand B 44..51 CDD:409353 1/6 (17%)
CDR1 51..59 CDD:409353 1/7 (14%)
Ig strand C 59..63 CDD:409353 1/3 (33%)
FR2 60..63 CDD:409353 1/2 (50%)
CDR2 67..81 CDD:409353 4/14 (29%)
Ig strand C' 68..72 CDD:409353 1/3 (33%)
Ig strand C' 79..81 CDD:409353 0/1 (0%)
FR3 84..115 CDD:409353 13/31 (42%)
Ig strand D 84..90 CDD:409353 3/6 (50%)
Ig strand E 94..102 CDD:409353 3/7 (43%)
Ig strand F 108..115 CDD:409353 3/6 (50%)
CDR3 116..124 CDD:409353 1/7 (14%)
FR4 124..130 CDD:409353 1/5 (20%)
Ig strand G 124..130 CDD:409353 1/5 (20%)
Ig_3 134..208 CDD:404760 24/96 (25%)
Ig strand B 153..157 CDD:409353 0/3 (0%)
Ig strand C 166..170 CDD:409353 2/5 (40%)
Ig strand E 187..191 CDD:409353 1/3 (33%)
Ig strand F 201..206 CDD:409353 2/4 (50%)
Ig strand G 215..218 CDD:409353
Ig 227..318 CDD:416386
Ig strand C 256..260 CDD:409353
Ig strand E 286..290 CDD:409353
Ig strand F 300..305 CDD:409353
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.