DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr14 and Lac

DIOPT Version :10

Sequence 1:NP_572419.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_523713.2 Gene:Lac / 36363 FlyBaseID:FBgn0010238 Length:359 Species:Drosophila melanogaster


Alignment Length:205 Identity:55/205 - (26%)
Similarity:86/205 - (41%) Gaps:35/205 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 YTTLNISTQLSSSVYLHCRVNDLQGKTVSWMRRRGDDLTLITFGQHTYSGDSRYSLEFEEPND-- 141
            |.|......:..:|...|.|...:...|.:::...|.:.|.| |......|||:||.: :||.  
  Fly    33 YITQEQIKDIGGTVEFDCSVQYAKEYNVLFLKTDSDPVFLST-GSTLVIKDSRFSLRY-DPNSST 95

  Fly   142 WKLLIQFANERDEGPYECQV--SSHPPLVLLVYLTIIVPHVEILDERGSATPEKYYKAGSTIELQ 204
            :||.|:...|.|.|.|.|||  |:...:...|.|::..|.| |.|   ::|.......||.::::
  Fly    96 YKLQIKDIQETDAGTYTCQVVISTVHKVSAEVKLSVRRPPV-ISD---NSTQSVVASEGSEVQME 156

  Fly   205 CVISKIPHPSSYITWRHGPRLLNYDTSRGGISVKTDMLPGRALSRLYIAN------ANRQDTGNY 263
            |..|..|.|:  ||||.          .....:.||       |..|:.|      ..::|.|.|
  Fly   157 CYASGYPTPT--ITWRR----------ENNAILPTD-------SATYVGNTLRIKSVKKEDRGTY 202

  Fly   264 TCMLGNEITE 273
            .|:..|.:::
  Fly   203 YCVADNGVSK 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr14NP_572419.1 Ig 81..175 CDD:472250 29/97 (30%)
Ig strand B 92..96 CDD:409353 1/3 (33%)
Ig strand C 105..109 CDD:409353 1/3 (33%)
Ig strand E 142..146 CDD:409353 2/3 (67%)
Ig strand F 156..161 CDD:409353 2/4 (50%)
Ig strand G 168..171 CDD:409353 0/2 (0%)
IG_like 191..279 CDD:214653 20/89 (22%)
Ig strand B 201..205 CDD:409473 0/3 (0%)
Ig strand C 214..220 CDD:409473 2/5 (40%)
Ig strand E 248..252 CDD:409473 1/3 (33%)
Ig strand F 262..267 CDD:409473 2/4 (50%)
LacNP_523713.2 IG_like 36..131 CDD:214653 28/96 (29%)
Ig strand B 46..50 CDD:409381 1/3 (33%)
Ig strand C 60..63 CDD:409381 1/2 (50%)
Ig strand E 96..100 CDD:409381 2/3 (67%)
Ig strand F 110..115 CDD:409381 2/4 (50%)
Ig strand G 124..127 CDD:409381 0/2 (0%)
Ig_3 134..208 CDD:464046 24/96 (25%)
Ig 227..318 CDD:472250
Ig strand C 256..260 CDD:409353
Ig strand E 286..290 CDD:409353
Ig strand F 300..305 CDD:409353
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.