| Sequence 1: | NP_001245573.1 | Gene: | dpr14 / 31702 | FlyBaseID: | FBgn0029974 | Length: | 340 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_006247755.1 | Gene: | Sdk2 / 360652 | RGDID: | 1310397 | Length: | 2175 | Species: | Rattus norvegicus |
| Alignment Length: | 219 | Identity: | 50/219 - (22%) |
|---|---|---|---|
| Similarity: | 85/219 - (38%) | Gaps: | 64/219 - (29%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 70 EPFPFFADPYTTLNISTQLSSSVYLHCRVNDLQGKTVSWMRRRGDDLTLITFGQHTYSGDSRYSL 134
Fly 135 EFEEPNDWKLLIQFANERDEGPYEC---------QVSSHPPLVLLVYLTIIVPHV-------EIL 183
Fly 184 DERGSATPEKYYKAGSTIELQCVISKIPHPSSYITWRHGPRLLNYDTSRGGISVKTDMLPGRAL- 247
Fly 248 --SRLYIANANRQDTGNYTCMLGN 269 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| dpr14 | NP_001245573.1 | IG_like | 83..163 | CDD:214653 | 17/88 (19%) |
| Ig | 84..169 | CDD:299845 | 18/93 (19%) | ||
| IG_like | 191..279 | CDD:214653 | 24/82 (29%) | ||
| Ig | 201..274 | CDD:143165 | 23/72 (32%) | ||
| Sdk2 | XP_006247755.1 | IG_like | 43..112 | CDD:214653 | |
| IGc2 | 43..101 | CDD:197706 | |||
| IG_like | 123..206 | CDD:214653 | |||
| Ig | 135..191 | CDD:299845 | |||
| IG_like | 225..307 | CDD:214653 | |||
| IGc2 | 236..289 | CDD:197706 | |||
| I-set | 311..400 | CDD:254352 | 20/109 (18%) | ||
| Ig | 329..397 | CDD:143165 | 17/80 (21%) | ||
| I-set | 405..495 | CDD:254352 | 26/102 (25%) | ||
| Ig | 419..495 | CDD:299845 | 24/75 (32%) | ||
| Ig | 505..589 | CDD:299845 | |||
| IG_like | 505..589 | CDD:214653 | |||
| FN3 | 593..684 | CDD:238020 | |||
| FN3 | 696..789 | CDD:238020 | |||
| FN3 | 797..893 | CDD:238020 | |||
| FN3 | 898..986 | CDD:238020 | |||
| FN3 | 996..1090 | CDD:238020 | |||
| FN3 | 1102..1197 | CDD:238020 | |||
| FN3 | 1204..1293 | CDD:238020 | |||
| FN3 | 1304..1397 | CDD:238020 | |||
| FN3 | 1403..1487 | CDD:238020 | |||
| FN3 | 1506..1619 | CDD:238020 | |||
| FN3 | 1629..1722 | CDD:238020 | |||
| FN3 | 1727..1808 | CDD:238020 | |||
| FN3 | 1840..1919 | CDD:238020 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||