DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr14 and DIP-zeta

DIOPT Version :9

Sequence 1:NP_001245573.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_723441.2 Gene:DIP-zeta / 34231 FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster


Alignment Length:220 Identity:57/220 - (25%)
Similarity:91/220 - (41%) Gaps:31/220 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 EELEVTETTTHEPFPFFADPYTTLNISTQLSSSVYLHCRVNDLQGKTVSWMRRRGDDLTLITFGQ 123
            ||.|.||...              |::.....:|.|.|.|.:|....|:||  ..:...::|...
  Fly   111 EEPEFTEYIE--------------NVTVPAGRNVKLGCSVKNLGSYKVAWM--HFEQSAILTVHN 159

  Fly   124 HTYSGDSRYSL---EFEEPNDWKLLIQFANERDEGPYECQVSSHPPLVLLVYLTIIVPHVEILDE 185
            |..:.:.|.|:   :.:....|.|.|...:|.|.|.|.||:::........||.::||  ..:|:
  Fly   160 HVITRNPRISVTHDKHDRHRTWYLHINNVHEEDRGRYMCQINTVTAKTQFGYLNVVVP--PNIDD 222

  Fly   186 RGSATPEKYYKAGSTIELQCVISKIPHPSSYITWRHGPRLLNYDTSRGGISVKTDMLPGRALSRL 250
            ..|:: :...:.|:.|.|:|..|..|.|  .|.|:..      |.||..|: |..::.......|
  Fly   223 SLSSS-DVIVREGANISLRCRASGSPRP--IIKWKRD------DNSRIAIN-KNHIVNEWEGDTL 277

  Fly   251 YIANANRQDTGNYTCMLGNEITETV 275
            .|...:|.|.|.|.|:..|.:..||
  Fly   278 EITRISRLDMGAYLCIASNGVPPTV 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr14NP_001245573.1 IG_like 83..163 CDD:214653 22/82 (27%)
Ig 84..169 CDD:299845 21/87 (24%)
IG_like 191..279 CDD:214653 24/85 (28%)
Ig 201..274 CDD:143165 21/72 (29%)
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 24/111 (22%)
Ig 130..200 CDD:143165 20/71 (28%)
I-set 226..310 CDD:254352 24/87 (28%)
IGc2 233..298 CDD:197706 22/73 (30%)
Ig 313..410 CDD:299845
IG_like 325..410 CDD:214653
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.