DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr14 and DIP-iota

DIOPT Version :10

Sequence 1:NP_572419.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001097100.1 Gene:DIP-iota / 33925 FlyBaseID:FBgn0031837 Length:376 Species:Drosophila melanogaster


Alignment Length:211 Identity:60/211 - (28%)
Similarity:97/211 - (45%) Gaps:20/211 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 PFFADPYTTLNISTQLSSSVYLHCRVNDLQGKTVSWMRRRGDDLTLITFGQHTYSGDSRYSLEFE 137
            |.|:.|..  |.:..:.....|.|.|:||....|:|:  |.|..|:::...|..:.:.|.|:...
  Fly    31 PKFSGPIN--NSTVPVGRDALLTCVVHDLVSFKVAWL--RVDTQTILSIQNHVITKNHRISISHT 91

  Fly   138 EPNDWKLLIQFANERDEGPYECQVSSHPPLVLLVYLTIIVPHVEILDERGSATPEKYYKAGSTIE 202
            |...|:|.|:...|.|.|.|.||:::.|....:.||.::|| .:|:|.:.|  .:.....|..:.
  Fly    92 EHRIWQLKIRDVQESDRGWYMCQINTDPMKSQMGYLDVVVP-PDIVDYQTS--QDVVRSTGQNVT 153

  Fly   203 LQCVISKIPHPSSYITWRH---GPRLLNYDTSRGGISVKTDMLPGRALSRLYIANANRQDTGNYT 264
            |.|..:.:|.|:  ||||.   .|.|::.|..|...||:     |:.|:   :....|...|.|.
  Fly   154 LTCSATGVPMPT--ITWRREEATPILISDDGDREVFSVE-----GQNLT---LWQVQRSHMGAYL 208

  Fly   265 CMLGNEITETVVVHVL 280
            |:..|.:..||...|:
  Fly   209 CIASNGVPPTVSKRVM 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr14NP_572419.1 Ig 81..175 CDD:472250 27/93 (29%)
Ig strand B 92..96 CDD:409353 1/3 (33%)
Ig strand C 105..109 CDD:409353 1/3 (33%)
Ig strand E 142..146 CDD:409353 2/3 (67%)
Ig strand F 156..161 CDD:409353 2/4 (50%)
Ig strand G 168..171 CDD:409353 0/2 (0%)
IG_like 191..279 CDD:214653 24/90 (27%)
Ig strand B 201..205 CDD:409473 1/3 (33%)
Ig strand C 214..220 CDD:409473 2/5 (40%)
Ig strand E 248..252 CDD:409473 0/3 (0%)
Ig strand F 262..267 CDD:409473 2/4 (50%)
DIP-iotaNP_001097100.1 IG_like 39..125 CDD:214653 25/87 (29%)
Ig strand B 48..52 CDD:143290 1/3 (33%)
Ig strand C 61..65 CDD:143290 1/3 (33%)
Ig strand E 96..100 CDD:143290 2/3 (67%)
Ig strand F 110..115 CDD:143290 2/4 (50%)
Ig 133..227 CDD:472250 28/104 (27%)
Ig strand B 152..156 CDD:409562 1/3 (33%)
Ig strand C 165..169 CDD:409562 2/5 (40%)
Ig strand E 192..196 CDD:409562 1/6 (17%)
Ig strand F 206..211 CDD:409562 2/4 (50%)
Ig strand G 220..223 CDD:409562 0/2 (0%)
Ig_3 231..310 CDD:464046
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.