DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr14 and DIP-theta

DIOPT Version :10

Sequence 1:NP_572419.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_723103.1 Gene:DIP-theta / 33795 FlyBaseID:FBgn0051646 Length:606 Species:Drosophila melanogaster


Alignment Length:240 Identity:70/240 - (29%)
Similarity:106/240 - (44%) Gaps:40/240 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 EDEELE------VTETTTHEPFPFFADPYTTLNISTQLSSSVYLHCRVNDLQGKTVSWMRRRGDD 115
            :||.||      |......:..|.|.:  ...|::..:|....|.|.|::||...::|:  |.|.
  Fly   108 KDELLEDIREDTVVNAIPEKDLPKFGE--LLQNVTVPVSREAVLQCVVDNLQTYKIAWL--RVDT 168

  Fly   116 LTLITFGQHTYSGDSRYSLEFEEPNDWKLLIQFANERDEGPYECQVSSHPPLVLLVYLTIIVPHV 180
            .|::|...|..:.:.|.|:...|...|.|.|:...|.|:|.|.||:::.|....:.||.::|| .
  Fly   169 QTILTIQNHVITKNHRMSITHAEKRAWILRIRDVKESDKGWYMCQINTDPMKSQVGYLDVVVP-P 232

  Fly   181 EILDERGSATPEKYYKAGSTIELQCVISKIPHPSSYITWRHGPRLLNYDTSRGGISVKTDMLPGR 245
            :|||...|.  :...:.||.:.|:|..:..|.|:  ||||.          .||..:.   ||..
  Fly   233 DILDYPTST--DMVIREGSNVTLKCAATGSPTPT--ITWRR----------EGGELIP---LPNG 280

  Fly   246 ALSRLY------IANANRQDTGNYTCMLGNEITETV------VVH 278
            |.:..|      ||..||.:.|.|.|:..|.|..||      :||
  Fly   281 AEAVAYNGSFLTIAKVNRLNMGAYLCIASNGIPPTVSKRVMLIVH 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr14NP_572419.1 Ig 81..175 CDD:472250 28/93 (30%)
Ig strand B 92..96 CDD:409353 1/3 (33%)
Ig strand C 105..109 CDD:409353 0/3 (0%)
Ig strand E 142..146 CDD:409353 2/3 (67%)
Ig strand F 156..161 CDD:409353 2/4 (50%)
Ig strand G 168..171 CDD:409353 0/2 (0%)
IG_like 191..279 CDD:214653 29/100 (29%)
Ig strand B 201..205 CDD:409473 1/3 (33%)
Ig strand C 214..220 CDD:409473 2/5 (40%)
Ig strand E 248..252 CDD:409473 1/9 (11%)
Ig strand F 262..267 CDD:409473 2/4 (50%)
DIP-thetaNP_723103.1 IG_like 137..230 CDD:214653 28/94 (30%)
Ig strand B 147..151 CDD:409353 1/3 (33%)
Ig strand C 160..164 CDD:409353 0/3 (0%)
Ig strand E 195..199 CDD:409353 2/3 (67%)
Ig strand F 209..214 CDD:409353 2/4 (50%)
Ig strand G 221..224 CDD:409353 0/2 (0%)
Ig 232..324 CDD:472250 31/108 (29%)
Ig strand B 251..255 CDD:409275 1/3 (33%)
Ig strand C 264..268 CDD:409275 2/5 (40%)
Ig strand E 289..293 CDD:409275 0/3 (0%)
Ig strand F 303..308 CDD:409275 2/4 (50%)
Ig strand G 317..320 CDD:409275 0/2 (0%)
Ig_3 327..408 CDD:464046
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.