DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr14 and itgb4

DIOPT Version :9

Sequence 1:NP_001245573.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster
Sequence 2:XP_005166847.1 Gene:itgb4 / 335269 ZFINID:ZDB-GENE-030131-7209 Length:1931 Species:Danio rerio


Alignment Length:291 Identity:59/291 - (20%)
Similarity:105/291 - (36%) Gaps:68/291 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 GDPFDTFPKNFWQEFSSPFTDTPEDEELEVTETTTHEPFPFFADPYTTLNISTQLSSSVYLHCRV 98
            ||..|.:...|     ..|.|...:.:.::......||:.....|::..|: .:|:|::....: 
Zfish   159 GDLSDDYTIGF-----GKFVDKVTEPQTDMRPAKLAEPWSNSDPPFSFRNV-IKLTSNITSFRQ- 216

  Fly    99 NDLQGKTVS------------------------WMRRRGDDLTLITFGQHTYSGDSRYSLEFEEP 139
             .||.:.:|                        |   |.|...|:.|     |.:|.:..|.:..
Zfish   217 -KLQKERISGNLDAPEGGFDAILQTAVCQDQIGW---RKDSTHLLVF-----STESAFHYEADGA 272

  Fly   140 NDWKLLIQFANERDE-------GPYECQV-SSHPPLVLLVYLTI---IVPHVEILDERGSATPEK 193
            |   :|....:..||       |.|...| ..:|.:..||.|.:   |:|...:.:...|.. ||
Zfish   273 N---VLAGILDRNDEQCHLNVDGNYTHDVRQDYPSIPTLVRLLVKHNIIPIFAVTNHSYSYY-EK 333

  Fly   194 YYKAGSTIELQCVISKIPHPSSYITWRHGPRLLN--YDTSRGGISVKTDMLPGRALSRLYIANAN 256
            .::.....||    .::...||.|.     .:|.  ::..|..||::.:..|....::::..:..
Zfish   334 LHEYFPIAEL----GQLQEDSSNIL-----SILEKAFENIRSKISIRAEDRPKAVETKIFSQSGT 389

  Fly   257 RQDTGNYTCMLGNEITETVVVHVLN--GEEP 285
            ..:.||:....|......|.:..||  ||||
Zfish   390 FSEYGNFKITPGQTGKFKVRMKALNQVGEEP 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr14NP_001245573.1 IG_like 83..163 CDD:214653 21/111 (19%)
Ig 84..169 CDD:299845 21/116 (18%)
IG_like 191..279 CDD:214653 16/89 (18%)
Ig 201..274 CDD:143165 13/74 (18%)
itgb4XP_005166847.1 Integrin_beta 37..457 CDD:278776 59/291 (20%)
EGF_2 <468..490 CDD:285248
EGF_2 545..573 CDD:285248
Integrin_B_tail 625..709 CDD:285239
Calx-beta 991..1064 CDD:295344
FN3 1242..1326 CDD:238020
FN3 1331..1420 CDD:238020
fn3 1640..1720 CDD:278470
fn3 1751..1835 CDD:278470
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.