DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr14 and dpr2

DIOPT Version :9

Sequence 1:NP_001245573.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001014480.4 Gene:dpr2 / 3346227 FlyBaseID:FBgn0261871 Length:410 Species:Drosophila melanogaster


Alignment Length:330 Identity:112/330 - (33%)
Similarity:159/330 - (48%) Gaps:49/330 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 SLHHIGSGSTSTTLKRPRAGDPFDT-----------FPKNFWQEFSSPFTDTPEDEELEVTETTT 68
            ||.|:..|: ...|....|....|.           ||     :|.:...|..|.||....|||.
  Fly    45 SLSHLVDGN-DNLLPMVSAPSSIDNDYVYIASVNRKFP-----QFGNSIDDEREAEEQPPEETTY 103

  Fly    69 HEPFPFFADPYTTLNISTQLSSSVYLHCRVNDLQGKTVSWMRRRGDDLTLITFGQHTYSGDSRYS 133
            ..|...|..|   .||:|:...:..::|||::|..|:|||:|:|  ||.::|.|..||:.|.|:.
  Fly   104 PPPVFDFGMP---RNITTRTGHTAAINCRVDNLGDKSVSWIRKR--DLHILTAGILTYTSDERFK 163

  Fly   134 -LEFEEPNDWKLLIQFANERDEGPYECQVSSHPPLVLLVYLTIIV--PHVEILDERGSATP-EKY 194
             :...:..||.|.:::|..||.|.|||||::.|.:.:...|.:||  |..:.:    .|.| :.|
  Fly   164 VVRTADSKDWTLHVKYAQPRDSGIYECQVNTEPKISMAFRLNVIVTPPDAKAI----IAGPTDLY 224

  Fly   195 YKAGSTIELQCVISKIPHPSSY----ITWRHGPRLLN----------YDTSRGGISVKTDMLPGR 245
            .|.||::.|.|.: |.|..|:.    |.|..||.:|.          .|..|  ||::: .|..:
  Fly   225 VKVGSSVTLTCHV-KQPATSAQDIGPIYWYRGPYILTPFVAHPNDAAIDLQR--ISMES-TLAEK 285

  Fly   246 ALSRLYIANANRQDTGNYTCMLGNEITETVVVHVLNGEEPAAMQHANGSRQKAN-ASTMVVLFLV 309
            ..|||.||||...||||||||.......:|||:|:|.|.|||||.:...|...: .|:.:||.|.
  Fly   286 LQSRLRIANAQLLDTGNYTCMPTTAEAASVVVNVINDESPAAMQKSRAIRTSGSMRSSRLVLLLA 350

  Fly   310 YVCIS 314
            .|..|
  Fly   351 MVASS 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr14NP_001245573.1 IG_like 83..163 CDD:214653 33/80 (41%)
Ig 84..169 CDD:299845 33/85 (39%)
IG_like 191..279 CDD:214653 38/102 (37%)
Ig 201..274 CDD:143165 30/86 (35%)
dpr2NP_001014480.4 IG_like 113..206 CDD:214653 36/97 (37%)
Ig 116..192 CDD:299845 30/77 (39%)
ig 220..306 CDD:278476 33/89 (37%)
IG_like 220..306 CDD:214653 33/89 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444717
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I3769
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X190
76.990

Return to query results.
Submit another query.