DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr14 and CG33543

DIOPT Version :9

Sequence 1:NP_001245573.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001014458.3 Gene:CG33543 / 3346207 FlyBaseID:FBgn0053543 Length:468 Species:Drosophila melanogaster


Alignment Length:186 Identity:39/186 - (20%)
Similarity:69/186 - (37%) Gaps:38/186 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 LHCRVNDLQGKTVSWMRRRGDDLTLITFGQHTYSGDSRYSLEFEEPNDWKLLIQFANERDEGPYE 158
            ::|.|..:....|||: ..|:.:..:...:|....:..|             |:..::.|.|.|.
  Fly   171 VNCFVEGMPAPEVSWL-YNGEYINTVNSTKHNRLSNGLY-------------IRNVSQADAGEYT 221

  Fly   159 CQVSSHPPLVL-LVYLTIIV-----PHVEILDERGSATPEKYYKAGSTIELQCVISKIPHPSSYI 217
            |:.....|... ...:||::     ||...    ....|.:|...|..:.|.|.....|.||  .
  Fly   222 CRA
MRITPTFSDSDQITILLRIQHKPHWFF----NETLPVQYAYVGGAVNLSCDAMGEPPPS--F 280

  Fly   218 TWRHGPRLLNYDTSRG--GISVKTDMLPGRALSRLYIANANRQDTGNYTCMLGNEI 271
            ||.|        .::|  |.:.:..:....|..:|.:.||::  .|:|.|.:.|.:
  Fly   281 TWLH--------NNKGIVGFNHRIFVADYGATLQLQMKNASQ--FGDYKCKVANPL 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr14NP_001245573.1 IG_like 83..163 CDD:214653 13/68 (19%)
Ig 84..169 CDD:299845 14/74 (19%)
IG_like 191..279 CDD:214653 21/83 (25%)
Ig 201..274 CDD:143165 18/73 (25%)
CG33543NP_001014458.3 IGc2 165..224 CDD:197706 13/66 (20%)
IG_like 256..336 CDD:214653 21/83 (25%)
IGc2 263..327 CDD:197706 19/76 (25%)
FN3 341..445 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.