DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr14 and dpr4

DIOPT Version :10

Sequence 1:NP_572419.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001014616.2 Gene:dpr4 / 3346160 FlyBaseID:FBgn0053512 Length:323 Species:Drosophila melanogaster


Alignment Length:43 Identity:13/43 - (30%)
Similarity:21/43 - (48%) Gaps:10/43 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 AIIACHFIYRYGTVELEF-------HKKYISGSKHLL--LYIG 137
            |:|.|.|...:..|..|.       |:|. :|:|.::  ||:|
  Fly  1025 ALIKCSFCEYHTHVASEMGLHMQNNHRKE-TGAKEVISDLYMG 1066

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr14NP_572419.1 Ig 81..175 CDD:472250 13/43 (30%)
Ig strand B 92..96 CDD:409353
Ig strand C 105..109 CDD:409353 1/3 (33%)
Ig strand E 142..146 CDD:409353
Ig strand F 156..161 CDD:409353
Ig strand G 168..171 CDD:409353
IG_like 191..279 CDD:214653
Ig strand B 201..205 CDD:409473
Ig strand C 214..220 CDD:409473
Ig strand E 248..252 CDD:409473
Ig strand F 262..267 CDD:409473
dpr4NP_001014616.2 IG_like 53..145 CDD:214653
Ig strand A' 55..57 CDD:409355
Ig strand B 61..69 CDD:409355
CDR1 69..75 CDD:409355
Ig strand C 76..82 CDD:409355
CDR2 85..101 CDD:409355
Ig strand D 101..106 CDD:409355
FR3 102..131 CDD:409355
Ig strand E 110..117 CDD:409355
Ig strand F 125..132 CDD:409355
IG_like 161..>227 CDD:214653
Ig strand B 166..170 CDD:409353
Ig strand C 181..185 CDD:409353
Ig strand E 206..214 CDD:409353
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.