DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr14 and dpr4

DIOPT Version :9

Sequence 1:NP_001245573.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001014616.2 Gene:dpr4 / 3346160 FlyBaseID:FBgn0053512 Length:323 Species:Drosophila melanogaster


Alignment Length:304 Identity:107/304 - (35%)
Similarity:156/304 - (51%) Gaps:44/304 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 PKNFWQ-EFSSPFTDTPEDEELEVTETTTHEPFPFFADPYTTLNISTQLSSSVYLHCRVNDLQGK 104
            |.::|: .:|.|:.|.....|:..|                       :..:..|||||.:|..:
  Fly    34 PPHYWETPYSQPYFDNSSRREVTAT-----------------------VGQAALLHCRVRNLGDR 75

  Fly   105 TVSWMRRRGDDLTLITFGQHTYSGDSRY-SLEFEEPNDWKLLIQFANERDEGPYECQVSSHPPLV 168
            .|||:|:|  ||.::|.|..||:.|.|: ||..|..::|.|.|.....||.|.||||||:.|.:.
  Fly    76 AVSWIRKR--DLHILTVGILTYTNDQRFQSLHSEGSDEWTLRISSPQPRDSGTYECQVSTEPKIS 138

  Fly   169 LLVYLTIIVPHVEILDERGSATPEKYYKAGSTIELQCVISKIPHPSSYITWRHGPRLLNYDTSRG 233
            ....|.::|...:||   |:|  |.:.|:||.|.|.|:..:.|.|.|:|.|..|.|::|| :.||
  Fly   139 QGFRLNVVVSRAKIL---GNA--ELFIKSGSDINLTCLAMQSPVPPSFIYWYKGKRVMNY-SQRG 197

  Fly   234 GISVKTDMLPGRALSRLYIANANRQDTGNYTCMLGNEITETVVVHVLNGEEPAAMQHANGS---- 294
            ||:|.|:.  ....|:|.||.|...|:|||||...:..:.:|||||:|||.||||||.|.|    
  Fly   198 GINVITER--STRTSKLLIAKATPADSGNYTCSPSSSDSASVVVHVINGEHPAAMQHGNSSATCL 260

  Fly   295 RQKANASTMVVLFLVYVCISGSISVAGMNRGLGLGQVWG--WGW 336
            |..::.|   |.|::...:|.:::....|..|.:...|.  |.|
  Fly   261 RPLSSTS---VPFVLATWMSMTVASVAWNSNLNINWNWSPDWRW 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr14NP_001245573.1 IG_like 83..163 CDD:214653 33/80 (41%)
Ig 84..169 CDD:299845 35/85 (41%)
IG_like 191..279 CDD:214653 36/87 (41%)
Ig 201..274 CDD:143165 29/72 (40%)
dpr4NP_001014616.2 V-set 53..146 CDD:284989 38/117 (32%)
IG_like 53..145 CDD:214653 38/116 (33%)
ig 153..227 CDD:278476 34/81 (42%)
IG_like 161..>227 CDD:214653 30/68 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444727
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I3769
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X190
87.890

Return to query results.
Submit another query.