DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr14 and DIP-beta

DIOPT Version :9

Sequence 1:NP_001245573.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster


Alignment Length:221 Identity:57/221 - (25%)
Similarity:92/221 - (41%) Gaps:37/221 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 PFFADPYTTLNISTQLSSSVYLHCRVNDLQGKTVS-----------WMRRRGDDLTLITFGQHTY 126
            |.|..|..  |::..........|.||:|.|..||           |:  :.|...::...:|..
  Fly    98 PDFVIPLE--NVTIAQGRDATFTCVVNNLGGHRVSGDGSSAPAKVAWI--KADAKAILAIHEHVI 158

  Fly   127 SGDSRYSLEFEEPNDWKLLIQFANERDEGPYECQVSSHPPLVLLVYLTIIVPHVEILDERGSA-- 189
            :.:.|.|::..:.|.|.|.|:.....|.|.|.|||::.|..:....|.:::| .:|::|..|.  
  Fly   159 TNNDRLSVQHNDYNTWTLNIRGVKMEDAGKYMCQVNTDPMKMQTATLEVVIP-PDIINEETSGDM 222

  Fly   190 -TPEKYYKAGSTIELQCVISKIPHPSSYITWRH--GPRLLNYDTSRGGISVKT--DMLPGRALSR 249
             .||     |.:.:|.|  ....||...||||.  |..::    :|.|...||  ..:.|..|: 
  Fly   223 MVPE-----GGSAKLVC--RARGHPKPKITWRREDGREII----ARNGSHQKTKAQSVEGEMLT- 275

  Fly   250 LYIANANRQDTGNYTCMLGNEITETV 275
              ::...|.:.|.|.|:..|.:..||
  Fly   276 --LSKITRSEMGAYMCIASNGVPPTV 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr14NP_001245573.1 IG_like 83..163 CDD:214653 23/90 (26%)
Ig 84..169 CDD:299845 23/95 (24%)
IG_like 191..279 CDD:214653 25/89 (28%)
Ig 201..274 CDD:143165 20/76 (26%)
DIP-betaNP_001138225.1 I-set 98..209 CDD:254352 28/114 (25%)
ig 102..195 CDD:278476 24/96 (25%)
IG_like 219..307 CDD:214653 26/95 (27%)
Ig 221..307 CDD:299845 25/93 (27%)
Ig 311..404 CDD:299845
IG_like 327..405 CDD:214653
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.