DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr14 and Opcml

DIOPT Version :10

Sequence 1:NP_572419.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster
Sequence 2:XP_006510497.1 Gene:Opcml / 330908 MGIID:97397 Length:354 Species:Mus musculus


Alignment Length:202 Identity:54/202 - (26%)
Similarity:90/202 - (44%) Gaps:33/202 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 FPFFADPYTTLNISTQLSSSVYLHCRVNDLQGKTVSWMRRRGDDLTLITFGQHTYSGDSRYSLEF 136
            ||...|     |::.:...|..|.|.::| :...|:|:.|.    |::..|...:|.|.|..:..
Mouse    38 FPKAMD-----NVTVRQGESATLRCTIDD-RVTRVAWLNRS----TILYAGNDKWSIDPRVIILV 92

  Fly   137 EEPNDWKLLIQFANERDEGPYEC--QVSSHPPLVLLVYLTIIVPHVEILDERGSATPEKYYKAGS 199
            ..|..:.::||..:..|||||.|  |..:||. ...|:|.:.|| .:|::.....|..:    ||
Mouse    93 NTPTQYSIMIQNVDVYDEGPYTCSVQTDNHPK-TSRVHLIVQVP-PQIMNISSDITVNE----GS 151

  Fly   200 TIELQCVISKIPHPSSYITWRHGPRLLNYDTSRGGISVKTDMLPGRALSRLYIANANRQDTGNYT 264
            ::.|.|:....|.|:  :||||    |:....:|.:|..         ..|.|::..|..:|.|.
Mouse   152 SVTLLCLAIGRPEPT--VTWRH----LSVKEGQGFVSED---------EYLEISDIKRDQSGEYE 201

  Fly   265 CMLGNEI 271
            |...|::
Mouse   202 CSALNDV 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr14NP_572419.1 Ig 81..175 CDD:472250 27/95 (28%)
Ig strand B 92..96 CDD:409353 1/3 (33%)
Ig strand C 105..109 CDD:409353 1/3 (33%)
Ig strand E 142..146 CDD:409353 0/3 (0%)
Ig strand F 156..161 CDD:409353 3/6 (50%)
Ig strand G 168..171 CDD:409353 0/2 (0%)
IG_like 191..279 CDD:214653 20/81 (25%)
Ig strand B 201..205 CDD:409473 1/3 (33%)
Ig strand C 214..220 CDD:409473 1/5 (20%)
Ig strand E 248..252 CDD:409473 1/3 (33%)
Ig strand F 262..267 CDD:409473 2/4 (50%)
OpcmlXP_006510497.1 Ig 44..132 CDD:472250 27/93 (29%)
Ig strand B 53..57 CDD:409353 1/3 (33%)
Ig strand C 65..69 CDD:409353 1/3 (33%)
Ig strand E 98..102 CDD:409353 0/3 (0%)
Ig strand F 112..117 CDD:409353 3/4 (75%)
Ig strand G 125..128 CDD:409353 0/2 (0%)
Ig_3 135..206 CDD:464046 22/90 (24%)
Ig 224..312 CDD:472250
Ig strand B 240..244 CDD:409353
Ig strand C 253..257 CDD:409353
Ig strand E 279..283 CDD:409353
Ig strand F 293..298 CDD:409353
Ig strand G 306..309 CDD:409353
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.