DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr14 and Sdk1

DIOPT Version :9

Sequence 1:NP_001245573.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_808547.3 Gene:Sdk1 / 330222 MGIID:2444413 Length:2193 Species:Mus musculus


Alignment Length:333 Identity:77/333 - (23%)
Similarity:117/333 - (35%) Gaps:113/333 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 SGSTSTTLKRPRAGDPFDTFPKNFWQEFSSPFTD--------------TPEDEELEVTETT---- 67
            :||:.|||:......|.:....: |:......|.              |..|..:.|.|.|    
Mouse   288 AGSSETTLECIANARPVEELSVH-WKRNGVRLTSGLHSYGRRLTITNPTSADTGMYVCEATLRGS 351

  Fly    68 THEPF-----------PFF-ADPYTTLNISTQLSSSVYLHCRVNDLQGKTVSWMRRRGDDLTLIT 120
            |.||.           |:| |:|.:  .|..::..::.:.||...:...|:.|.:   |.:.|..
Mouse   352 TFEPARARAFLSIIEPPYFTAEPES--RILGEVEETMDIPCRAMGVPLPTLQWYK---DAVPLSK 411

  Fly   121 FGQHTY----SGDSRYSLEFEEPNDWKLLIQFANERDEGPYEC-------QVSSHPPLVLLVYL- 173
            .....|    ||.              |.||..:..|.|.::|       :|.:|      .|| 
Mouse   412 LQNPRYKVLPSGG--------------LHIQKLSPEDSGIFQCFASNEGGEVQTH------TYLD 456

  Fly   174 -TIIVPHVEILDERGSATPEKYYKAGSTIELQCVISKIPHPSSYITWRHGPRLLNYDTSRGGISV 237
             |.|.|   ...:|...|.   ...|.|..|:|.:|..|.|:  |||:.|    |:..:.|.:.:
Mouse   457 VTNIAP---AFTQRPVDTT---VTDGMTAVLRCEVSGAPKPA--ITWKRG----NHILASGSVRI 509

  Fly   238 KTDML---PGRALSRLYIANANRQDTGNYTCMLGNEITETVVVHVLNGEEPAAMQHANGSRQKAN 299
            ...||   .|..::.::|     ||.|||||...|  ||..|                      |
Mouse   510 PRFMLLESGGLRIAPVFI-----QDAGNYTCYAAN--TEASV----------------------N 545

  Fly   300 ASTMVVLF 307
            ||.|:.::
Mouse   546 ASAMLTVW 553

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr14NP_001245573.1 IG_like 83..163 CDD:214653 17/90 (19%)
Ig 84..169 CDD:299845 18/95 (19%)
IG_like 191..279 CDD:214653 28/90 (31%)
Ig 201..274 CDD:143165 24/75 (32%)
Sdk1NP_808547.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..56
Ig_2 94..169 CDD:290606
IG_like 100..169 CDD:214653
IG_like 183..263 CDD:214653
Ig 197..247 CDD:299845
IG_like 281..357 CDD:214653 16/69 (23%)
IGc2 294..347 CDD:197706 9/53 (17%)
I-set 368..457 CDD:254352 24/113 (21%)
Ig 388..454 CDD:143165 17/88 (19%)
I-set 462..552 CDD:254352 35/130 (27%)
Ig 476..552 CDD:299845 32/110 (29%)
I-set 557..646 CDD:254352
Ig 562..646 CDD:299845
FN3 650..741 CDD:238020
fn3 753..839 CDD:278470
FN3 854..949 CDD:238020
FN3 954..1036 CDD:238020
FN3 1052..1148 CDD:238020
FN3 1158..1253 CDD:238020
FN3 1261..1349 CDD:238020
FN3 1360..1453 CDD:238020
FN3 1459..1554 CDD:238020
FN3 1562..1676 CDD:238020
FN3 1686..1779 CDD:238020
FN3 1784..1865 CDD:238020
FN3 1885..1978 CDD:238020
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 2057..2080
PDZ-binding. /evidence=ECO:0000250|UniProtKB:Q6V4S5 2187..2193
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.