DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr14 and dpr18

DIOPT Version :9

Sequence 1:NP_001245573.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_573102.1 Gene:dpr18 / 32572 FlyBaseID:FBgn0030723 Length:519 Species:Drosophila melanogaster


Alignment Length:374 Identity:117/374 - (31%)
Similarity:167/374 - (44%) Gaps:88/374 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LHHIGSGSTSTTLKRPRAG------------DPFD-TFPKNFWQEFSSPF---TDTPEDEELEVT 64
            :.::|:....||:..|...            .|.| |..:|.|.  :|.|   |:.|..:...  
  Fly   151 IKNVGTTDQLTTVTMPTTAFASLKVDRSTMKQPIDSTRTRNHWT--ASGFARVTERPRSKHHH-- 211

  Fly    65 ETTTHEPFPFFADPYTTLNISTQLSSSVY------LHCRVNDLQGKTVSWMRRRGDDLTLITFGQ 123
               .|...|||.:|..:......|.|:|:      |:|||..|:.|||.|:||..:.::|:|.|.
  Fly   212 ---EHHWGPFFEEPINSATSGDNLVSAVHLFTEAVLNCRVGMLKDKTVMWVRRTAEKVSLLTVGN 273

  Fly   124 HTYSGDSRYSLEFEEPNDWKLLIQFANERDEGPYECQVSSHPPLVLLVYLTIIVPHVEILDERGS 188
            .|||||.|..::|:.||:|:|||......|.|.|.||||:|||.|....||::.|.:.|:||...
  Fly   274 VTYSGDPRIRVKFQYPNNWRLLINPTQTEDAGVYMCQVSTHPPRVFTTNLTVLEPPLRIIDEHER 338

  Fly   189 ATPEKYYKAGSTIELQCVISK----------------------------------------IPHP 213
            ...::|||:|||::|||.||:                                        ..|.
  Fly   339 DVGDRYYKSGSTVDLQCQISRSFFQKERQTILKSTDSANDAVQKLINETTSELNLIGNVNQTQHK 403

  Fly   214 SS----------YITWRHGPRLLNYDTSRGGISVKTDMLPGRALSRLYIANANRQDTGNYTCMLG 268
            .|          :|||......|...|:| .:||....|    .||:.|.:|...|:|||:|.||
  Fly   404 FSGQDLEKYFTKFITWAKDEEPLQGMTNR-RLSVSDVWL----TSRISIGDAKLSDSGNYSCSLG 463

  Fly   269 NEITETVVVHVLNGEEPAAMQHANGSRQK----ANASTMVVLFLVYVCI 313
            ...|..|.|.||.||.|||:||..|||.:    |....::||..::.|:
  Fly   464 RLFTVIVQVQVLTGELPAAVQHNIGSRTEIYSLAMLGHLLVLIFLFTCL 512

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr14NP_001245573.1 IG_like 83..163 CDD:214653 36/85 (42%)
Ig 84..169 CDD:299845 40/90 (44%)
IG_like 191..279 CDD:214653 36/137 (26%)
Ig 201..274 CDD:143165 28/122 (23%)
dpr18NP_573102.1 IG_like 242..325 CDD:214653 39/82 (48%)
Ig <258..326 CDD:299845 32/67 (48%)
IGc2 <417..461 CDD:197706 17/48 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 42 1.000 Inparanoid score I5499
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303091at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.970

Return to query results.
Submit another query.