DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr14 and dpr8

DIOPT Version :9

Sequence 1:NP_001245573.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001285239.1 Gene:dpr8 / 32387 FlyBaseID:FBgn0052600 Length:344 Species:Drosophila melanogaster


Alignment Length:319 Identity:105/319 - (32%)
Similarity:158/319 - (49%) Gaps:56/319 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 IIYSSLHHIGSGSTSTTLKRPRAGDPFDTFPKNFWQEFSSPFTDTPEDEELEVTETTTHEPFPFF 75
            ||:..:..:.:|.|....||         |..:|.|:..:|.|..|..:                
  Fly     6 IIFLGILCLLAGCTDGASKR---------FFTDFLQDLPTPGTGGPTFD---------------- 45

  Fly    76 ADPYTTL--NISTQLSSSVYLHCRVNDLQGKTVSWMRRRGDDLTLITFGQHTYSGDSRY-SLEFE 137
                ||:  ||:..:..:|.|.|||.:|..:||||:|.|  |:.|:|.|::||:.|.|: ::...
  Fly    46 ----TTIGTNITGLVGKTVKLTCRVKNLGNRTVSWVRHR--DIHLLTVGRYTYTSDQRFEAMHSP 104

  Fly   138 EPNDWKLLIQFANERDEGPYECQVSSHPPLVLLVYLTIIVPHVEILDERGSATPEKYYKAGSTIE 202
            ...||.|.|::|..:|.|.||||:|:.||:...|||.|:.|..:|:     ..||.:...||||.
  Fly   105 HAEDWTLRIRYAQRKDSGIYECQISTTPPIGHSVYLNIVEPVTDII-----GGPELHINRGSTIN 164

  Fly   203 LQCVISKIPHPSSYITWRHGPRLLNYDTSRGGISVKTD--MLPGRALSRLYIANANRQDTGNYTC 265
            |.|::...|.|...:.|.|...::|:|:.|||||:.|:  :|   ..|||.:..|..||:|.|||
  Fly   165 LTCIVKFAPEPPPTVIWSHNREIINFDSPRGGISLVTEKGVL---TTSRLLVQKAITQDSGLYTC 226

  Fly   266 MLGNEITETVVVHVLNGEEPAAMQHANGSRQKAN------------ASTMVVLFLVYVC 312
            ...|....:|.||:::||.||||...|.....|:            .||:::|.||..|
  Fly   227 TPSNANPTSVRVHIVDGEHPAAMHTGNNGNSTASQPPVLLPLVLLTCSTLMLLQLVASC 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr14NP_001245573.1 IG_like 83..163 CDD:214653 33/80 (41%)
Ig 84..169 CDD:299845 35/85 (41%)
IG_like 191..279 CDD:214653 34/89 (38%)
Ig 201..274 CDD:143165 27/74 (36%)
dpr8NP_001285239.1 IG_like 51..131 CDD:214653 34/81 (42%)
V-set 52..143 CDD:284989 38/92 (41%)
IG_like 153..238 CDD:214653 33/87 (38%)
ig 153..232 CDD:278476 32/81 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I3769
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X190
76.960

Return to query results.
Submit another query.