DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr14 and DIP-kappa

DIOPT Version :9

Sequence 1:NP_001245573.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_723828.1 Gene:DIP-kappa / 318958 FlyBaseID:FBgn0051814 Length:672 Species:Drosophila melanogaster


Alignment Length:222 Identity:62/222 - (27%)
Similarity:101/222 - (45%) Gaps:25/222 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 TETTTHE--PFPFFADPYTTLNISTQLSSSVYLHCRVNDLQGKTVSWMRRRGDDLTLITFGQHTY 126
            |:.|..|  .||.||:|..  |::..:.....:.|.|.:|:|..|:|:  |.|..|:::...:..
  Fly    63 TQQTAQEDSDFPRFAEPIA--NVTVSVGRDALMACVVENLKGYKVAWV--RVDTQTILSIHHNVI 123

  Fly   127 SGDSRYSLEFEEPNDWKLLIQFANERDEGPYECQVSSHPPLVLLVYLTIIVPHVEILDERGSATP 191
            |.:||.||.:.:...|.|.|:...|.|.|.|.|||::.|......||.::||.:.:   .|..:.
  Fly   124 SQNSRISLTYNDHRSWYLHIKEVEETDRGWYMCQVNTDPMRSRKGYLQVVVPPIIV---EGLTSN 185

  Fly   192 EKYYKAGSTIELQCVISKIPHPSSYITWRH--GPRLLNYDTSRGGISVKTDMLPGRALSRLYIAN 254
            :...:.|..|.|.|.....|.|  |:.||.  |..:|     .||..|  :::.|..   |:|..
  Fly   186 DMVVREGQNISLVCKARGYPEP--YVMWRREDGEEML-----IGGEHV--NVVDGEL---LHITK 238

  Fly   255 ANRQDTGNYTCMLGNEITETVV--VHV 279
            .:|.....|.|:..|.:..::.  ||:
  Fly   239 VSRLHMAAYLCVASNGVPPSISKRVHL 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr14NP_001245573.1 IG_like 83..163 CDD:214653 25/79 (32%)
Ig 84..169 CDD:299845 25/84 (30%)
IG_like 191..279 CDD:214653 22/91 (24%)
Ig 201..274 CDD:143165 20/74 (27%)
DIP-kappaNP_723828.1 Ig 80..172 CDD:299845 28/95 (29%)
IG_like 82..174 CDD:214653 28/93 (30%)
IG_like 184..267 CDD:214653 23/94 (24%)
IGc2 191..255 CDD:197706 21/75 (28%)
IG_like 282..368 CDD:214653
Ig 288..367 CDD:143165
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.