Sequence 1: | NP_001245573.1 | Gene: | dpr14 / 31702 | FlyBaseID: | FBgn0029974 | Length: | 340 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001259218.1 | Gene: | DIP-alpha / 31322 | FlyBaseID: | FBgn0052791 | Length: | 554 | Species: | Drosophila melanogaster |
Alignment Length: | 207 | Identity: | 50/207 - (24%) |
---|---|---|---|
Similarity: | 91/207 - (43%) | Gaps: | 20/207 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 73 PFFADPYTTLNISTQLSSSVYLHCRVNDLQGKTVSWMRRRGDDLTLITFGQHTYSGDSRYSLEFE 137
Fly 138 EPNDWKLLIQFANERDEGPYECQVSSHPPLVLLVYLTIIVPHVEILDERGS--ATPEKYYKAGST 200
Fly 201 IELQCVISKIPHPSSYITWRH--GPRLLNYDTSRGGISVKTDMLPGRALSRLYIANANRQDTGNY 263
Fly 264 TCMLGNEITETV 275 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr14 | NP_001245573.1 | IG_like | 83..163 | CDD:214653 | 20/79 (25%) |
Ig | 84..169 | CDD:299845 | 20/84 (24%) | ||
IG_like | 191..279 | CDD:214653 | 23/87 (26%) | ||
Ig | 201..274 | CDD:143165 | 18/74 (24%) | ||
DIP-alpha | NP_001259218.1 | IG_like | 49..129 | CDD:214653 | 20/83 (24%) |
Ig | 51..131 | CDD:299845 | 19/81 (23%) | ||
I-set | 144..240 | CDD:254352 | 25/101 (25%) | ||
IGc2 | 159..228 | CDD:197706 | 21/80 (26%) | ||
Ig | 244..337 | CDD:299845 | |||
I-set | 244..337 | CDD:254352 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 46 | 1.000 | Domainoid score | I11916 |
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |