DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr14 and DIP-alpha

DIOPT Version :9

Sequence 1:NP_001245573.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001259218.1 Gene:DIP-alpha / 31322 FlyBaseID:FBgn0052791 Length:554 Species:Drosophila melanogaster


Alignment Length:207 Identity:50/207 - (24%)
Similarity:91/207 - (43%) Gaps:20/207 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 PFFADPYTTLNISTQLSSSVYLHCRVNDLQGKTVSWMRRRGDDLTLITFGQHTYSGDSRYSLEFE 137
            |.|.:..:  |:|..:.......|.|..|.|..|.|:  :.|...:....::..:.:.|.::...
  Fly    42 PEFVESIS--NVSVAVGRDATFTCHVRHLGGYRVGWL--KADTKAIQAIHENVITHNPRVTVSHL 102

  Fly   138 EPNDWKLLIQFANERDEGPYECQVSSHPPLVLLVYLTIIVPHVEILDERGS--ATPEKYYKAGST 200
            :.|.|.|.|:..:|.|.|.|.||:::.|....:.:|.:::|...|.::..|  ..||     ||:
  Fly   103 DQNTWNLHIKAVSEEDRGGYMCQLNTDPMKSQIGFLDVVIPPDFISEDTSSDVIVPE-----GSS 162

  Fly   201 IELQCVISKIPHPSSYITWRH--GPRLLNYDTSRGGISVKTDMLPGRALSRLYIANANRQDTGNY 263
            :.|.|.....|.|  .:|||.  |..::..|    .:..|| :.|......|.::..:|.:.|:|
  Fly   163 VRLTCRARGYPEP--IVTWRREDGNEIVLKD----NVGTKT-LAPSFRGEVLKLSKISRNEMGSY 220

  Fly   264 TCMLGNEITETV 275
            .|:..|.:..:|
  Fly   221 LCIASNGVPPSV 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr14NP_001245573.1 IG_like 83..163 CDD:214653 20/79 (25%)
Ig 84..169 CDD:299845 20/84 (24%)
IG_like 191..279 CDD:214653 23/87 (26%)
Ig 201..274 CDD:143165 18/74 (24%)
DIP-alphaNP_001259218.1 IG_like 49..129 CDD:214653 20/83 (24%)
Ig 51..131 CDD:299845 19/81 (23%)
I-set 144..240 CDD:254352 25/101 (25%)
IGc2 159..228 CDD:197706 21/80 (26%)
Ig 244..337 CDD:299845
I-set 244..337 CDD:254352
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.