DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr14 and kirre

DIOPT Version :9

Sequence 1:NP_001245573.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001245505.1 Gene:kirre / 31292 FlyBaseID:FBgn0028369 Length:956 Species:Drosophila melanogaster


Alignment Length:312 Identity:78/312 - (25%)
Similarity:109/312 - (34%) Gaps:96/312 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 SLHHIGSGSTSTTL-----------------KRPRAGDPFDTFPKNFWQEFSSPFTDTPEDEELE 62
            |.||..|.|:|::.                 .:|:.||       |..|.|:.    .|:|:   
  Fly    41 SSHHGDSSSSSSSSSSSSGSSSAAASSANDESKPKGGD-------NGGQHFAM----EPQDQ--- 91

  Fly    63 VTETTTHEPFPFFADPYTTLNISTQLSSSVYLHCRVNDLQGKTVSWMRRRGDDLTLITFGQH-TY 126
                                  :..:.|.|.|.|||.:..| .:.|.:   ||..|   ||| ..
  Fly    92 ----------------------TAVVGSRVTLPCRVMEKVG-ALQWTK---DDFGL---GQHRNL 127

  Fly   127 SGDSRYSL-EFEEPNDWKLLIQFANERDEGPYECQVSSHPP-----LVLLVYLTIIVPHVEILDE 185
            ||..|||: ..:|..|:.|.|......|:..|:|||...|.     ......||::||     .|
  Fly   128 SGFERYSMVGSDEEGDFSLDIYPLMLDDDAKYQCQVGPGPQGEQGIRSRFAKLTVLVP-----PE 187

  Fly   186 RGSATPEKYY--KAGSTIELQCVISKIPHPSSYITWRHGPRLLNYDTSRGGISVKTDMLPGR--- 245
            ....|...|.  .....|||:|| |:...|::.|||..|   |....::|...||..:...|   
  Fly   188 APKITQGDYLVTTEDREIELECV-SQGGKPAAEITWIDG---LGNVLTKGIEYVKEPLADSRRIT 248

  Fly   246 ALSRLYIANANRQDTGNYTCMLGNEITET---------------VVVHVLNG 282
            |.|.|.:|.........:||...|....|               |:|.|:.|
  Fly   249 ARSILKLAPKKEHHNTTFTCQAQNTADRTYRSAKLLLEVKYAPKVIVSVVGG 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr14NP_001245573.1 IG_like 83..163 CDD:214653 28/81 (35%)
Ig 84..169 CDD:299845 29/91 (32%)
IG_like 191..279 CDD:214653 27/107 (25%)
Ig 201..274 CDD:143165 23/75 (31%)
kirreNP_001245505.1 Ig 87..183 CDD:299845 33/127 (26%)
IG_like 88..182 CDD:214653 32/125 (26%)
C2-set_2 189..279 CDD:285423 26/93 (28%)
Ig_2 307..379 CDD:290606
I-set 382..462 CDD:254352
IGc2 396..446 CDD:197706
Ig 466..561 CDD:299845
IG_like 478..561 CDD:214653
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.