DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr14 and Iglon5

DIOPT Version :10

Sequence 1:NP_572419.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001419161.1 Gene:Iglon5 / 308557 RGDID:1305344 Length:336 Species:Rattus norvegicus


Alignment Length:270 Identity:64/270 - (23%)
Similarity:92/270 - (34%) Gaps:77/270 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SRLFWILAIIYSSLHHIGSGSTSTTLKRPRAGDPFDTFPKNFWQEFSSPFTDTPEDEELEVTETT 67
            :||..:.|...:.|..|..|..|.:|                  |||||                
  Rat     8 ARLRLLAAAALAGLAVISRGLLSQSL------------------EFSSP---------------- 38

  Fly    68 THEPFPFFADPYTTLNISTQLSSSVYLHCRVNDLQGKTVSWMRRRGDDLTLITFGQHTYSGDSRY 132
                    ||.||...     ..:..|.|.: |.....|:|:.|.    .::..|...::.|.|.
  Rat    39 --------ADNYTVCE-----GDNATLSCFI-DEHVTRVAWLNRS----NILYAGNDRWTSDPRV 85

  Fly   133 SLEFEEPNDWKLLIQFANERDEGPYECQVSS-HPPLVLLVYLTIIVPHVEILDERGSATPEKYYK 196
            .|....|.::.:||......|||.|.|...: |.|....|||.:.||...:......|..|    
  Rat    86 RLLINTPEEFSILITQVGLGDEGLYTCSFQTRHQPYTTQVYLIVHVPARIVNISSPVAVNE---- 146

  Fly   197 AGSTIELQCVISKIPHPSSYITWRHGPRLLNYDTSRGGISVKTDMLPGRALSRLYIANANRQDTG 261
             |..:.|.|:....|.|:  :|||   :|.:..||.|.|              |.|::..|...|
  Rat   147 -GGNVNLLCLAVGRPEPT--VTWR---QLRDGFTSEGEI--------------LEISDIQRGQAG 191

  Fly   262 NYTCMLGNEI 271
            .|.|:..|.:
  Rat   192 EYECVTHNGV 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr14NP_572419.1 Ig 81..175 CDD:472250 23/94 (24%)
Ig strand B 92..96 CDD:409353 1/3 (33%)
Ig strand C 105..109 CDD:409353 1/3 (33%)
Ig strand E 142..146 CDD:409353 0/3 (0%)
Ig strand F 156..161 CDD:409353 2/4 (50%)
Ig strand G 168..171 CDD:409353 0/2 (0%)
IG_like 191..279 CDD:214653 21/81 (26%)
Ig strand B 201..205 CDD:409473 1/3 (33%)
Ig strand C 214..220 CDD:409473 1/5 (20%)
Ig strand E 248..252 CDD:409473 1/3 (33%)
Ig strand F 262..267 CDD:409473 2/4 (50%)
Iglon5NP_001419161.1 Ig 41..129 CDD:472250 25/97 (26%)
Ig strand B 50..54 CDD:409382 1/3 (33%)
Ig strand C 62..66 CDD:409382 1/3 (33%)
Ig strand E 95..99 CDD:409382 0/3 (0%)
Ig strand F 109..114 CDD:409382 2/4 (50%)
Ig strand G 122..125 CDD:409382 0/2 (0%)
Ig_3 134..199 CDD:464046 21/88 (24%)
Ig_3 217..295 CDD:464046
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.