DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr14 and dpr9

DIOPT Version :9

Sequence 1:NP_001245573.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001287332.1 Gene:dpr9 / 2768670 FlyBaseID:FBgn0038282 Length:602 Species:Drosophila melanogaster


Alignment Length:322 Identity:103/322 - (31%)
Similarity:159/322 - (49%) Gaps:48/322 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ILAIIYSSLHHIGSGSTSTTLKRPRAGDPFDTFPKNFWQEFSSPFTDTPEDEELEVTETTTHEPF 72
            |..|..||||...|.|::|                     |||..........:::.|.....| 
  Fly   214 ITGIPSSSLHKASSASSNT---------------------FSSQLASGFHRNSIDLEEARNAGP- 256

  Fly    73 PFFADPYTTLNISTQLSSSVYLHCRVNDLQGKT----VSWMRRRGDDLTLITFGQHTYSGDSRY- 132
              :.|...:.|::..|..:.||:|||.:|..||    |||:|.|  |:.|:|.|::||:.|.|: 
  Fly   257 --YFDKAFSKNVTALLGKTAYLNCRVKNLGNKTMLLQVSWVRHR--DIHLLTVGRYTYTSDQRFR 317

  Fly   133 SLEFEEPNDWKLLIQFANERDEGPYECQVSSHPPLVLLVYLTIIVPHVEILDERGSATPEKYYKA 197
            ::...:..||.|.|::...||.|.||||||:.|.:...::|.::.|..||:     ..|:.|.::
  Fly   318 AIHQPQTEDWMLQIKYPQHRDSGIYECQVSTTPHMSHYIHLNVVEPSTEII-----GAPDLYIES 377

  Fly   198 GSTIELQCVISKIPHPSSYITWRHG------PRLLNYDTSRGGISVKTDMLPGRALSRLYIANAN 256
            ||||.|.|:|...|.|.:||.|.|.      |:::|||:.|||:||.|:. .....|.|.|.:|.
  Fly   378 GSTINLTCIIQNSPEPPAYIFWNHNNAFPSHPQIINYDSPRGGVSVVTNK-GDTTTSFLLIKSAR 441

  Fly   257 RQDTGNYTCMLGNEITETVVVHVLNGEEPA---AMQHANGSRQKANASTMV--VLFLVYVCI 313
            ..|:|:|.|...|...::|.||||||...:   .:..:|.:|..:.:|.:.  :...|.||:
  Fly   442 PSDSGHYQCNPSNAKPKSVTVHVLNGVSHSVSRGVPSSNAARGTSASSPLAHSLSVCVPVCV 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr14NP_001245573.1 IG_like 83..163 CDD:214653 35/84 (42%)
Ig 84..169 CDD:299845 36/89 (40%)
IG_like 191..279 CDD:214653 36/93 (39%)
Ig 201..274 CDD:143165 29/78 (37%)
dpr9NP_001287332.1 Ig 263..361 CDD:299845 38/99 (38%)
IG_like 263..360 CDD:214653 38/98 (39%)
IG_like 371..464 CDD:214653 36/93 (39%)
IGc2 377..456 CDD:197706 32/79 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444722
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I5030
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X190
87.890

Return to query results.
Submit another query.