DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr14 and Jaml

DIOPT Version :9

Sequence 1:NP_001245573.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster
Sequence 2:XP_006510445.4 Gene:Jaml / 270152 MGIID:2685484 Length:405 Species:Mus musculus


Alignment Length:271 Identity:56/271 - (20%)
Similarity:102/271 - (37%) Gaps:56/271 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 ISTQLSSSVYLHCRVNDLQGK---TVSWM--RRRGDDLTLITFGQHTYSGDSRYSLEFEE----- 138
            :...:..||.:.|.|...:.|   .|.|:  :.:.|....:.|   .||..|..:..|:.     
Mouse    59 LRVHVGESVLMGCVVQRTEEKHVDRVDWLFSKDKDDASEYVLF---YYSNLSVPTGRFQNRSHLV 120

  Fly   139 ----PNDWKLLIQFANERDEGPYECQVS-SHPPLVLLVYLTIIVPHVEILDERGSATPEKYYKAG 198
                .||..||:|...:.|||.|.|::. .:..:|:...:.:.|...|..|.|        .:.|
Mouse   121 GDTFHNDGSLLLQDVQKADEGIYTCEIRLKNESMVMKKPVELWVL
PEEPKDLR--------VRVG 177

  Fly   199 STIELQCVISKIPHPS-SYITWRHG-------PRLLNYDTS------------RGGISVKTDMLP 243
            .|.:::|.|....... :.:.|...       ..:|:||::            |..:.:..|:  
Mouse   178 DTTQMRCSIQSTEEKRVTKVNWMFSSGSHTEEETVLSYDSNMRSGKFQSLGRFRNRVDLTGDI-- 240

  Fly   244 GRALSRLYIANANRQDTGNYTCML--GN-EITETVVVHVLNGEEPAAMQHA----NGSRQKANAS 301
            .|....:.:......|.|.|||.:  |. |..:|:|:||:..|....:...    .|.:...|.:
Mouse   241 SRNDGSIKLQTVKESDQGIYTCSIYVGKLESRKTIVLHVVQDEFQRTISPTPPTDKGQQGILNGN 305

  Fly   302 TMVVLFLVYVC 312
            .:|::..: ||
Mouse   306 QLVIIVGI-VC 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr14NP_001245573.1 IG_like 83..163 CDD:214653 23/93 (25%)
Ig 84..169 CDD:299845 23/99 (23%)
IG_like 191..279 CDD:214653 20/110 (18%)
Ig 201..274 CDD:143165 16/95 (17%)
JamlXP_006510445.4 V-set 55..165 CDD:369466 24/108 (22%)
V-set 167..280 CDD:369466 24/122 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 42 1.000 Inparanoid score I5499
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.