DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr14 and Lsamp

DIOPT Version :10

Sequence 1:NP_572419.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster
Sequence 2:XP_030104997.1 Gene:Lsamp / 268890 MGIID:1261760 Length:392 Species:Mus musculus


Alignment Length:249 Identity:69/249 - (27%)
Similarity:97/249 - (38%) Gaps:45/249 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 FWQE-----FSSPFTDTPEDEELEVTETTTHEPFPFFADPYT--TLNISTQLSSSVYLHCRVNDL 101
            ||.:     ..||.| .|..||....:....|..|..:..:.  |.||:.:...:..|.|.|.|.
Mouse    26 FWNQPPAEVNLSPIT-IPGTEETMRKKAKEEEGLPVRSVDFNRGTDNITVRQGDTAILRCVVEDK 89

  Fly   102 QGKTVSWMRRRGDDLTLITFGQHTYSGDSRYSLEFEEPNDWKLLIQFANERDEGPYECQV-SSHP 165
            ..| |:|:.|.|    :|..|...:|.|.|..||.....::.|.||..:..|||.|.|.| :.|.
Mouse    90 NSK-VAWLNRSG----IIFAGHDKWSLDPRVELEKRHALEYSLRIQKVDVYDEGSYTCSVQTQHE 149

  Fly   166 PLVLLVYLTIIVPHVEILDERGSATPEKYYKAGSTIELQCVISKIPHPSSYITWRHGPRLLNYDT 230
            |....|||.:.||     .:..:.:.:.....||.:.|.|:.:..|.|  .|||||         
Mouse   150 PKTSQVYLIVQVP-----PKISNISSDVTVNEGSNVTLVCMANGRPEP--VITWRH--------- 198

  Fly   231 SRGGISVKTDMLP-GRAL----SRLYIANANRQDTGNYTCMLGNEITETVVVHV 279
                      :.| ||..    ..|.|....|:.:|.|.|...||::...|..|
Mouse   199 ----------LTPLGREFEGEEEYLEILGITREQSGKYECKAANEVSSADVKQV 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr14NP_572419.1 Ig 81..175 CDD:472250 33/94 (35%)
Ig strand B 92..96 CDD:409353 1/3 (33%)
Ig strand C 105..109 CDD:409353 1/3 (33%)
Ig strand E 142..146 CDD:409353 1/3 (33%)
Ig strand F 156..161 CDD:409353 2/4 (50%)
Ig strand G 168..171 CDD:409353 0/2 (0%)
IG_like 191..279 CDD:214653 23/92 (25%)
Ig strand B 201..205 CDD:409473 1/3 (33%)
Ig strand C 214..220 CDD:409473 2/5 (40%)
Ig strand E 248..252 CDD:409473 1/3 (33%)
Ig strand F 262..267 CDD:409473 2/4 (50%)
LsampXP_030104997.1 Ig 69..159 CDD:472250 33/94 (35%)
Ig strand B 80..84 CDD:409353 1/3 (33%)
Ig strand C 92..96 CDD:409353 2/4 (50%)
Ig strand E 125..129 CDD:409353 1/3 (33%)
Ig strand F 139..144 CDD:409353 2/4 (50%)
Ig strand G 152..155 CDD:409353 0/2 (0%)
Ig_3 162..232 CDD:464046 21/95 (22%)
Ig_3 249..325 CDD:464046
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.