DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr14 and LRIT1

DIOPT Version :9

Sequence 1:NP_001245573.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_056428.1 Gene:LRIT1 / 26103 HGNCID:23404 Length:623 Species:Homo sapiens


Alignment Length:376 Identity:82/376 - (21%)
Similarity:123/376 - (32%) Gaps:116/376 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LFWILAIIY-------------SSLHHIGSGSTSTTLKRPRAGDPFDTFPKNFWQEFSSPFTDTP 56
            :.|:||:.:             .|||.:|.||.:.|:.   ..||..|.|         |.:..|
Human     7 MLWLLALAWPPQARGFCPSQCSCSLHIMGDGSKARTVV---CNDPDMTLP---------PASIPP 59

  Fly    57 EDEELEVTETTTHE-PFPFFAD---------PYTTLNISTQLSSSVYLHCRVNDLQGKTVS---W 108
            :...|.:..|.... |...|..         ||..|:....|........|...|.|..::   |
Human    60 DTSRLRLERTAIRRVPGEAFRPLGRLEQLWLPYNALSELNALMLRGLRRLRELRLPGNRLAAFPW 124

  Fly   109 MR-RRGDDLTLITFGQHTYSGDSRYSLEFEEPNDWKLLIQFANERDEGPYECQVS---------- 162
            .. |....|.|:....:..|.....:..|.|  :...|...:|:....|.|..||          
Human   125 AALRDAPKLRLLDLQANRLSAVPAEAARFLE--NLTFLDLSSNQLMRLPQELIVSWAHLETGIFP 187

  Fly   163 --SHPPLVL---------------LVYL------TIIVPHVEI---------------LDERGSA 189
              .||..||               ||:|      .:.....|:               |:.|...
Human   188 PGHHPRRVLGLQDNPWACDCRLYDLVHLLDGWAPNLAFIETELRCASPRSLAGVAFSQLELRKCQ 252

  Fly   190 TPEKY-------YKAGSTIELQCVISKIPHPSSYITWRH-GPRLLN----YDTSRGGISVKTDML 242
            .||.:       ...|.|..|:|..:.:|.|.  ::||. ..|.||    .:.|..|.|.....|
Human   253 GPELHPGVASIRSLLGGTALLRCGATGVPGPE--MSWRRANGRPLNGTVHQEVSSDGTSWTLLGL 315

  Fly   243 PGRALSRLYIANANRQDTGNYTCMLGNEI--TETVVVHVLNGEEPAAMQHA 291
            |  |:|.|        |:|:|.|...|.:  :|||:..::. |.|.:.:|:
Human   316 P--AVSHL--------DSGDYICQAKNFLGASETVISLIVT-EPPTSTEHS 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr14NP_001245573.1 IG_like 83..163 CDD:214653 17/95 (18%)
Ig 84..169 CDD:299845 19/100 (19%)
IG_like 191..279 CDD:214653 29/101 (29%)
Ig 201..274 CDD:143165 22/79 (28%)
LRIT1NP_056428.1 LRR 1 60..81 4/20 (20%)
leucine-rich repeat 61..84 CDD:275378 4/22 (18%)
LRR_8 63..143 CDD:290566 15/79 (19%)
LRR 2 84..105 4/20 (20%)
leucine-rich repeat 85..132 CDD:275378 9/46 (20%)
LRR 3 108..129 4/20 (20%)
LRR_8 131..202 CDD:290566 15/72 (21%)
LRR_4 131..171 CDD:289563 7/41 (17%)
LRR 4 132..153 3/20 (15%)
leucine-rich repeat 133..156 CDD:275378 5/24 (21%)
LRR 5 156..177 4/20 (20%)
leucine-rich repeat 157..180 CDD:275378 6/22 (27%)
leucine-rich repeat 181..205 CDD:275378 4/23 (17%)
TPKR_C2 201..>240 CDD:301599 4/38 (11%)
Ig 267..345 CDD:299845 27/89 (30%)
IG_like 267..345 CDD:214653 27/89 (30%)
FN3 431..498 CDD:214495
LRR 6. /evidence=ECO:0000305 571..594
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.