DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr14 and NEGR1

DIOPT Version :9

Sequence 1:NP_001245573.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_776169.2 Gene:NEGR1 / 257194 HGNCID:17302 Length:354 Species:Homo sapiens


Alignment Length:318 Identity:74/318 - (23%)
Similarity:113/318 - (35%) Gaps:99/318 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 FPFFADPYTTLNISTQLSSSVYLHCRVNDLQGKTVSWMRRRGDDLTLITFGQHTYSGDSRYSLEF 136
            ||:.|    ..|:..:...:..|.|.:.|...|. :|:.|.    ::|..|...:|.|.|.|:..
Human    40 FPWAA----VDNMMVRKGDTAVLRCYLEDGASKG-AWLNRS----SIIFAGGDKWSVDPRVSIST 95

  Fly   137 EEPNDWKLLIQFANERDEGPYECQV-SSHPPLVLLVYLTIIVPHVEILDERGSATPEKYYKAGST 200
            ....|:.|.||..:..|:|||.|.| :.|.|..:.|:||:.|| .:|.|.....|..:    |:.
Human    96 LNKRDYSLQIQNVDVTDDGPYTCSVQTQHTPRTMQVHLTVQVP-PKIYDISNDMTVNE----GTN 155

  Fly   201 IELQCVISKIPHPSSYITWRH----------GPRLLNYDTSRG-----GISVKTD---------- 240
            :.|.|:.:..|.||  |:|||          |..|..|..:|.     ..|.:.|          
Human   156 VTLTCLATGKPEPS--ISWRHISPSAKPFENGQYLDIYGITRDQAGEYECSAENDVSFPDVRKVK 218

  Fly   241 ----------------MLPGRA--------------------------------------LSRLY 251
                            :.|||:                                      .|.|.
Human   219 VVVNFAPTIQEIKSGTVTPGRSGLIRCEGAGVPPPAFEWYKGEKKLFNGQQGIIIQNFSTRSILT 283

  Fly   252 IANANRQDTGNYTCMLGNEITETVVVHVLNGEEPAAMQHA-NGSRQKANASTMVVLFL 308
            :.|..::..|||||:..|::..|.....||  .|:..|:. .||.....:...:||.|
Human   284 VTNVTQEHFGNYTCVAANKLGTTNASLPLN--PPSTAQYGITGSADVLFSCWYLVLTL 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr14NP_001245573.1 IG_like 83..163 CDD:214653 23/80 (29%)
Ig 84..169 CDD:299845 24/85 (28%)
IG_like 191..279 CDD:214653 29/166 (17%)
Ig 201..274 CDD:143165 27/151 (18%)
NEGR1NP_776169.2 IG 47..135 CDD:214652 27/92 (29%)
IGc2 152..210 CDD:197706 16/63 (25%)
Ig_3 225..301 CDD:372822 11/75 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.